Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  X-RAY CRYSTAL STRUCTURE OF PROTEIN Q6FF54 FROM ACINETOBACTER SP. ADP1. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET ASR1.
 
Authors :  A. P. Kuzin, M. Abashidze, S. M. Vorobiev, F. Forouhar, T. Acton, R. Xiao Northeast Structural Genomics Consortium (Nesg)
Date :  01 Nov 05  (Deposition) - 06 Dec 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.40
Chains :  Asym./Biol. Unit :  A
Keywords :  Q5Ff54, Asr1, Nesg, Structural Genomics, Psi, Protein Structure Initiative, Northeast Structural Genomics Consortium, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. P. Kuzin, M. Abashidze, S. M. Vorobiev, F. Forouhar, T. Acton, R. Xiao, L. -C. Ma, K. E. Cunningham, G. T. Montelione, J. F. Hunt
Novel X-Ray Structure Of Hypothetical Protein Q6Ff54 At The Resolution 1. 4 A. Northeast Structural Genomics Target Asr1
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN ACIAD0353
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET21
    Expression System StrainBL21(DE3) + MAGIC
    Expression System Taxid562
    Expression System Vector TypePLASMID
    MutationYES
    Organism ScientificACINETOBACTER SP.
    Organism Taxid62977
    StrainADP1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
1MSE2Mod. Amino AcidSELENOMETHIONINE
2SO42Ligand/IonSULFATE ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:91 , SER A:105 , LYS A:106 , ASP A:107 , ASP A:173 , HOH A:292 , HOH A:339BINDING SITE FOR RESIDUE SO4 A 221
2AC2SOFTWAREHIS A:67 , ARG A:120 , TYR A:121 , HOH A:243 , HOH A:247 , HOH A:257 , HOH A:298 , HOH A:315 , HOH A:319BINDING SITE FOR RESIDUE SO4 A 222

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2EW0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2EW0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2EW0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2EW0)

(-) Exons   (0, 0)

(no "Exon" information available for 2EW0)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:175
 aligned with Y353_ACIAD | Q6FF54 from UniProtKB/Swiss-Prot  Length:184

    Alignment length:175
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174     
           Y353_ACIAD     5 YLTHRCLIAPPEMADDFFANTVIYLARHDDEGAQGLIINRPSGIQVRELLNDLDIEADHVQPHEVLQGGPLRPEAGFVLHTGQPVWHSSIAVGENLCITTSKDILDAIAHNEGVGRYQIALGYASWTKNQLEGEISRGDWLICDADMDLIFNLPYDERWDAAYKKLGVDRIWLSS 179
               SCOP domains d2ew0a1 A:5-179 Hypothetical protein ACIAD0353                                                                                                                                  SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.............eeeeeeee..eeeeee...eeeeehhhhhhhh..........eeee...eeeeeeeeeee.......eeeee..eeee..hhhhhhhhh......eeeeeeeeee..hhhhhhhhh...eeee.hhhhhh..hhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ew0 A   5 YLTHRCLIAPPEmADDFFANTVIYLARHDEEGAQGIIINRPAGIQIKELLNDLDIDADNVNPHEVLQGGPLRPEAGFVLHTGQPTWHSSIAVGENVCITTSKDILDAIAHNEGVGRYQIALGYASWGKNQLEDEIARGDWLICDADmDLIFNLPYDDRWDAAYKKIGVDRTWLAS 179
                                    14  |     24        34        44        54        64        74        84        94       104       114       124       134       144      |154       164       174     
                                       17-MSE                                                                                                                               151-MSE                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2EW0)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2EW0)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2EW0)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ew0)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ew0
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Y353_ACIAD | Q6FF54
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Y353_ACIAD | Q6FF54
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2EW0)

(-) Related Entries Specified in the PDB File

asr1