|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2EVN) |
Sites (0, 0)| (no "Site" information available for 2EVN) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2EVN) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2EVN) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2EVN) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2EVN) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:103 aligned with Y1754_ARATH | Q9CAQ2 from UniProtKB/Swiss-Prot Length:114 Alignment length:103 21 31 41 51 61 71 81 91 101 111 Y1754_ARATH 12 MATEPPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVFKSSI 114 SCOP domains d2evna1 A:1-103 Hypothetical protein AT1g77540 SCOP domains CATH domains 2evnA00 A:1-103 [code=3.40.630.30, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------GNAT_YJDJ PDB: A:7-95 UniProt: 18-106 -------- PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 2evn A 1 MATEPPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVFKSSI 103 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EVN) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (Y1754_ARATH | Q9CAQ2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|