Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CONSERVED HYPOTHETICAL PROTEIN- STREPTOCOCCUS PYOGENES
 
Authors :  J. Jiang, T. Min, J. Gorman, L. Shapiro, S. K. Burley, New York Sgx Res Center For Structural Genomics (Nysgxrc)
Date :  26 Oct 05  (Deposition) - 07 Feb 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Hypothetical Protein, Streptococcus Pyogenes, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Jiang, T. Min, J. Gorman, L. Shapiro
Crystal Structure Of Hypothetical Protein Of Streptococcus Pygenes
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - METHYLTRANSFERASE
    Chains: A, B
    EC Number: 2.1.1.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: MODIFIED PET 26B
    Expression System Strain: BL21 (DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: SPY1538
    Organism Scientific: STREPTOCOCCUS PYOGENES
    Organism Taxid: 286636
    Strain: MGAS10394

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 11)

Asymmetric/Biological Unit (2, 11)
No.NameCountTypeFull Name
1GLC1Ligand/IonALPHA-D-GLUCOSE
2MSE10Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPHE B:40 , ASN B:41 , GLY B:42 , ASP B:112 , GLN B:141 , VAL B:142 , MSE B:143 , HIS B:182 , HIS B:185BINDING SITE FOR RESIDUE GLC B 300

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2ESR)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Gly A:37 -Pro A:38
2Gly B:37 -Pro B:38

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2ESR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2ESR)

(-) Exons   (0, 0)

(no "Exon" information available for 2ESR)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:160
 aligned with Q5XAY9_STRP6 | Q5XAY9 from UniProtKB/TrEMBL  Length:179

    Alignment length:160
                                                                                                                                                                                 179        
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177 |       -
         Q5XAY9_STRP6    28 VRGAIFNMIGPYFNGGRVLDLFAGSGGLAIEAVSRGMSAAVLVEKNRKAQAIIQDNIIMTKAENRFTLLKMEAERAIDCLTGRFDLVFLDPPYAKETIVATIEALAAKNLLSEQVMVVCETDKTVLLPKEIATLGIWKEKIYGISKVTVYVN--------   -
               SCOP domains d2esra1 A:28-179 Putative methyltransferase SPy1538                                                                                                     -------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh......eeeee....hhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhhhhh.eeee..hhhhhhhhh...eeeeee...hhhhhhhhhhhhhhhh..eeeeeeeeeeee.......ee..eeeeeeeee..eeeeeeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2esr A  28 VRGAIFNmIGPYFNGGRVLDLFAGSGGLAIEAVSRGmSAAVLVEKNRKAQAIIQDNIImTKAENRFTLLKmEAERAIDCLTGRFDLVFLDPPYAKETIVATIEALAAKNLLSEQVmVVCETDKTVLLPKEIATLGIWKEKIYGISKVTVYVNEGHHHHHH 187
                                   |37        47        57      | 67        77        87        97|      107       117       127       137     | 147       157       167       177       187
                                  35-MSE                       64-MSE                86-MSE      98-MSE                                      143-MSE                                        


Chain B from PDB  Type:PROTEIN  Length:160
 aligned with Q5XAY9_STRP6 | Q5XAY9 from UniProtKB/TrEMBL  Length:179

    Alignment length:160
                                                                                                                                                                                 179        
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177 |       -
         Q5XAY9_STRP6    28 VRGAIFNMIGPYFNGGRVLDLFAGSGGLAIEAVSRGMSAAVLVEKNRKAQAIIQDNIIMTKAENRFTLLKMEAERAIDCLTGRFDLVFLDPPYAKETIVATIEALAAKNLLSEQVMVVCETDKTVLLPKEIATLGIWKEKIYGISKVTVYVN--------   -
               SCOP domains d2esrb_ B: Putative methyltransferase SPy1538                                                                                                                    SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh......eeee.....hhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhhhhh.eeee..hhhhhhhhh...eeeeee..hhhhhhhhhhhhhhhhh..eeeeeeeeeeee.......ee..eeeeeeeee..eeeeeeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2esr B  28 VRGAIFNmIGPYFNGGRVLDLFAGSGGLAIEAVSRGmSAAVLVEKNRKAQAIIQDNIImTKAENRFTLLKmEAERAIDCLTGRFDLVFLDPPYAKETIVATIEALAAKNLLSEQVmVVCETDKTVLLPKEIATLGIWKEKIYGISKVTVYVNEGHHHHHH 187
                                   |37        47        57      | 67        77        87        97|      107       117       127       137     | 147       157       167       177       187
                                  35-MSE                       64-MSE                86-MSE      98-MSE                                      143-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2ESR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2ESR)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q5XAY9_STRP6 | Q5XAY9)
molecular function
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
    GO:0031167    rRNA methylation    The posttranscriptional addition of methyl groups to specific residues in an rRNA molecule.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:37 - Pro A:38   [ RasMol ]  
    Gly B:37 - Pro B:38   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2esr
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5XAY9_STRP6 | Q5XAY9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q5XAY9_STRP6 | Q5XAY9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2ESR)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2ESR)