2ERX - JenaLib

Title :   CRYSTAL STRUCTURE OF DIRAS2 IN COMPLEX WITH GDP AND INORGANIC PHOSPHATE

Authors :   E. Papagrigoriou, X. Yang, J. Elkins, F. E. Niesen, N. Burgess, E. Salah, O. Fedorov, L. J. Ball, F. Von Delft, M. Sundstrom, A. Edwards, C. Arrowsmith, J. Weigelt, D. Doyle

Date :   25 Oct 05 (Deposition) - 01 Nov 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.65

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Diras2, Gtp Hydrolysis, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. Papagrigoriou, X. Yang, J. Elkins, F. E. Niesen, N. Burgess, E. Salah, O. Fedorov, L. J. Ball, F. Von Delft, M. Sundstrom, A. Edwards, C. Arrowsmith, J. Weigelt, D. Doyle
Crystal Structure Of Diras2
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 6)

Sites (6, 6)

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY B:16 , LYS B:20 , TYR B:36 , THR B:39 , THR B:63 , GLY B:64 , SER B:65 , GDP B:401 , MG B:403 , HOH B:477 , HOH B:483	BINDING SITE FOR RESIDUE PO4 B 402
2	AC2	SOFTWARE	SER B:21 , THR B:39 , GDP B:401 , PO4 B:402 , HOH B:477 , HOH B:483	BINDING SITE FOR RESIDUE MG B 403
3	AC3	SOFTWARE	GLY A:16 , LYS A:20 , TYR A:36 , THR A:39 , THR A:63 , GLY A:64 , GDP A:401 , MG A:403 , HOH A:494 , HOH A:495	BINDING SITE FOR RESIDUE PO4 A 402
4	AC4	SOFTWARE	SER A:21 , THR A:39 , GDP A:401 , PO4 A:402 , HOH A:494 , HOH A:495	BINDING SITE FOR RESIDUE MG A 403
5	AC5	SOFTWARE	GLY B:17 , VAL B:18 , GLY B:19 , LYS B:20 , SER B:21 , SER B:22 , PHE B:32 , ARG B:33 , GLU B:34 , TYR B:36 , ASN B:121 , LYS B:122 , ASP B:124 , GLU B:125 , SER B:151 , ALA B:152 , LYS B:153 , PO4 B:402 , MG B:403 , HOH B:407 , HOH B:414 , HOH B:440 , HOH B:477 , HOH B:483 , HOH B:492	BINDING SITE FOR RESIDUE GDP B 401
6	AC6	SOFTWARE	GLY A:17 , VAL A:18 , GLY A:19 , LYS A:20 , SER A:21 , SER A:22 , PHE A:32 , ARG A:33 , GLU A:34 , TYR A:36 , ASN A:121 , LYS A:122 , ASP A:124 , GLU A:125 , SER A:151 , ALA A:152 , LYS A:153 , PO4 A:402 , MG A:403 , HOH A:445 , HOH A:464 , HOH A:486 , HOH A:494 , HOH A:495	BINDING SITE FOR RESIDUE GDP A 401

SS Bonds (1, 1)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (1, 2)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:168
 aligned with DIRA2_HUMAN | Q96HU8 from UniProtKB/Swiss-Prot  Length:199

    Alignment length:171
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175 
          DIRA2_HUMAN     6 NDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSL 176
               SCOP domains d2erxa1 A:6-176 di-Ras2                                                                                                                                                     SCOP domains
               CATH domains 2erxA00 A:6-176 P-loop containing nucleotide triphosphate hydrolases                                                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.....hhhhhhhhhhh............eeeeeeeee..eeeeeeeee......hhhhhhhhhhhh.eeeeeee..hhhhhhhhhhhhhhhhhhhh---...eeeeeehhhhhhhh..hhhhhhhhhhhhh.eeee.......hhhhhhhhhhhh.....ee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: A:6-176 (gaps) UniProt: 1-211 [INCOMPLETE]                                                                                                                   Transcript 1
                 2erx A   6 NDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKG---SIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSL 176
                                    15        25        35        45        55        65        75        85        95       105   |   115       125       135       145       155       165       175 
                                                                                                                                 109 113

Chain B from PDB  Type:PROTEIN  Length:166
 aligned with DIRA2_HUMAN | Q96HU8 from UniProtKB/Swiss-Prot  Length:199

    Alignment length:172
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174  
          DIRA2_HUMAN     5 SNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSL 176
               SCOP domains d2erxb_ B: automated matches                                                                                                                                                 SCOP domains
               CATH domains 2erxB00 B:5-176 P-loop containing nucleotide t  riphosphate hydrolases                                                                                                       CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee.....hhhhhhhhhhhh...........eeeeeee..--..eeeeeee......hhhhhhhhhhhh.eeeeeee..hhhhhhhhhhhhhhhhhhh----...eeeeee...hhhhh..hhhhhhhhhhhhh.eeee.......hhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: B:5-176 (gaps) UniProt: 1-211 [INCOMPLETE]                                                                                                                    Transcript 1
                 2erx B   5 SNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISC--SICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIK----SIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSL 176
                                    14        24        34        44     |  54        64        74        84        94       104   |   114       124       134       144       154       164       174  
                                                                        50 53                                                    108  113

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Asymmetric Unit(hide GO term definitions)

Chain A,B (DIRA2_HUMAN | Q96HU8)

molecular function
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
	GO:0043406	positive regulation of MAP kinase activity	Any process that activates or increases the frequency, rate or extent of MAP kinase activity.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0007264	small GTPase mediated signal transduction	Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
cellular component
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GDP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2erx)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2erx
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DIRA2_HUMAN \| Q96HU8
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description