|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (2, 4) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2DU9) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2DU9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2DU9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2DU9) |
Exons (0, 0)| (no "Exon" information available for 2DU9) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:116 aligned with Q8NLJ5_CORGL | Q8NLJ5 from UniProtKB/TrEMBL Length:121 Alignment length:116 12 22 32 42 52 62 72 82 92 102 112 Q8NLJ5_CORGL 3 VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGMFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESRG 118 SCOP domains -------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------- Transcript 2du9 A 3 VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGmFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESRG 118 12 22 32 42 52 62 | 72 82 92 102 112 66-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2DU9) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2DU9) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2DU9) |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (Q8NLJ5_CORGL | Q8NLJ5)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|