|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2D9M) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2D9M) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2D9M) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (2, 2)
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:69 aligned with Z3H7A_HUMAN | Q8IWR0 from UniProtKB/Swiss-Prot Length:971 Alignment length:99 872 882 892 902 912 922 932 942 952 Z3H7A_HUMAN 863 GKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFPTGYFSICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIGPNDNDFG 961 SCOP domains --------------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------ZF_C3H1 PDB: A:906-928--------------------------------- PROSITE Transcript 1 (1) Exon 1.22 PDB: A:885-909 (gaps) [INCOMPLETE] ---------------------------------------------------- Transcript 1 (1) Transcript 1 (2) ----------------------------------------------Exon 1.23a PDB: A:909-953 (gaps) UniProt: 909-971 Transcript 1 (2) 2d9m A 885 GSSGSS----------------------GQYCWQHRFPTGYFSICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKAS-----GPSS---G 953 | - - 892 902 912 922 932 942 | - | | | 890 891 948 949 | 953 952
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2D9M) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2D9M) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2D9M) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (Z3H7A_HUMAN | Q8IWR0)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|