Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  HYPOTHETICAL PROTEIN FROM PYROCOCCUS HORIKOSHII OT3
 
Authors :  T. B. Hiyama, S. Sekine, S. Yokoyama, Riken Structural Genomics/Pro Initiative (Rsgi)
Date :  31 Oct 05  (Deposition) - 31 Oct 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A
Keywords :  Coa Binding, Hypothetical Protein, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. B. Hiyama, M. Zhao, Y. Kitago, M. Yao, S. Sekine, T. Terada, C. Kuroishi, Z. J. Liu, J. P. Rose, S. Kuramitsu, M. Shirouzu, N. Watanabe, S. Yokoyama, I. Tanaka, B. C. Wang
Structural Basis Of Coa Recognition By The Pyrococcus Single-Domain Coa-Binding Proteins.
J. Struct. Funct. Genom. V. 7 119 2006
PubMed-ID: 17342453  |  Reference-DOI: 10.1007/S10969-007-9015-6

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN PH1109
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: PH1109
    Organism Scientific: PYROCOCCUS HORIKOSHII
    Organism Taxid: 70601
    Strain: OT3

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1COA1Ligand/IonCOENZYME A

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:2 , GLY A:29 , SER A:31 , LYS A:33 , ARG A:36 , ASP A:37 , ASN A:56 , PRO A:57 , LYS A:58 , TYR A:59 , PHE A:84 , VAL A:85 , LYS A:86 , LEU A:89 , TYR A:93 , GLN A:108 , TYR A:109 , CYS A:132 , MET A:134 , ARG A:135 , HOH A:1013 , HOH A:1018 , HOH A:1021 , HOH A:1023 , HOH A:1083 , HOH A:1119BINDING SITE FOR RESIDUE COA A 200

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2D5A)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2D5A)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2D5A)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2D5A)

(-) Exons   (0, 0)

(no "Exon" information available for 2D5A)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:142
 aligned with O58836_PYRHO | O58836 from UniProtKB/TrEMBL  Length:144

    Alignment length:142
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140  
         O58836_PYRHO     1 MEETRPIDGLTDEDIREILTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPKYEEVLGRKCYPSVLDIPDKIEVVDLFVKPKLTMEYVEQAIKKGAKVVWFQYNTYNREASKKADEAGLIIVANRCMMREHERLLG 142
               SCOP domains d2d5aa_ A: Hypothetical protein PH1109                                                                                                         SCOP domains
               CATH domains 2d5aA00 A:1-142 NAD(P)-binding Rossmann-like Domain                                                                                            CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhh.eeeee.......hhhhhhhhhhhhh..eeeee.....ee..ee...hhhhh.....eeee..hhhhhhhhhhhhhhhh..eeee.....hhhhhhhhhhh..eeee..hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2d5a A   1 MEETRPIDGLTDEDIREILTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPKYEEVLGRKCYPSVLDIPDKIEVVDLFVKPKLTMEYVEQAIKKGAKVVWFQYNTYNREASKKADEAGLIIVANRCMMREHERLLG 142
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2D5A)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (O58836_PYRHO | O58836)
molecular function
    GO:0048037    cofactor binding    Interacting selectively and non-covalently with a cofactor, a substance that is required for the activity of an enzyme or other protein. Cofactors may be inorganic, such as the metal atoms zinc, iron, and copper in certain forms, or organic, in which case they are referred to as coenzymes. Cofactors may either be bound tightly to active sites or bind loosely with the substrate.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    COA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2d5a)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2d5a
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O58836_PYRHO | O58836
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  O58836_PYRHO | O58836
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        O58836_PYRHO | O58836: 2d59 2e6u

(-) Related Entries Specified in the PDB File

2d59 PH1109 WITHOUT LIGAND RELATED ID: PHO001001109.2 RELATED DB: TARGETDB