|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 10)
Asymmetric Unit (3, 10)
|
Sites (10, 10)
Asymmetric Unit (10, 10)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2CZS) |
Cis Peptide Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2CZS) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2CZS) |
Exons (0, 0)| (no "Exon" information available for 2CZS) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:70 aligned with Q748S4_GEOSL | Q748S4 from UniProtKB/TrEMBL Length:94 Alignment length:70 94 37 47 57 67 77 87 | - Q748S4_GEOSL 28 VRTKKVPLDTNHKRFYDAFAQGAGKLDLDRQCVECHHEKPGGIPFPKNHPVKPADGPMRCLFCHKFK--- - SCOP domains ---------------------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 2czs A 28 VRTKKVPLDTNHKRFYDAFAQGAGKLDLDRQCVECHHEKPGGIPFPKNHPVKPADGPMRCLFCHKFKLEH 97 37 47 57 67 77 87 97 Chain B from PDB Type:PROTEIN Length:69 aligned with Q748S4_GEOSL | Q748S4 from UniProtKB/TrEMBL Length:94 Alignment length:69 94 37 47 57 67 77 87 | Q748S4_GEOSL 28 VRTKKVPLDTNHKRFYDAFAQGAGKLDLDRQCVECHHEKPGGIPFPKNHPVKPADGPMRCLFCHKFK-- - SCOP domains --------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------- Transcript 2czs B 28 VRTKKVPLDTNHKRFYDAFAQGAGKLDLDRQCVECHHEKPGGIPFPKNHPVKPADGPMRCLFCHKFKLE 96 37 47 57 67 77 87
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2CZS) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2CZS) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2CZS) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A,B (Q748S4_GEOSL | Q748S4)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|