|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric/Biological Unit (2, 4) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2CX0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2CX0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2CX0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2CX0) |
Exons (0, 0)| (no "Exon" information available for 2CX0) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:184 aligned with Q9YEQ6_AERPE | Q9YEQ6 from UniProtKB/TrEMBL Length:178 Alignment length:184 1 1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 Q9YEQ6_AERPE - ---------MARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGK 175 SCOP domains d2cx0a2 A:0-90 Hypothetical protein APE0525, N-terminal domain d2cx0a1 A:91-183 Hypothetical protein APE0525, C-terminal domain SCOP domains CATH domains 2cx0A01 A:0-87,A:171-183 Pre-PUA domain; domain 1 2cx0A02 A:88-170 [code=2.30.130.10, no name defined] 2cx0A01 CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2cx0 A 0 HmLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLmIPGVVGVEGSFTRGDVVAALYHETRTPVmVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGK 183 | 9 19 29 39 49 59 69 79 89 99 109 | 119 129 139| 149 159 169 179 | 111-MSE 140-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (2, 2)
Asymmetric/Biological Unit
|
CATH Domains (2, 2)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2CX0) |
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q9YEQ6_AERPE | Q9YEQ6)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|