Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CONSERVED PROTEIN TTHA0727 FROM THERMUS THERMOPHILUS HB8
 
Authors :  K. Ito, R. Arai, E. Fusatomi, T. Kamo-Uchikubo, S. Kawaguchi, T. Terada M. Shirouzu, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  23 Jun 05  (Deposition) - 23 Dec 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A,B,C  (2x)
Keywords :  Conserved Hypothetical Protein, All Alpha, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Ito, R. Arai, E. Fusatomi, T. Kamo-Uchikubo, S. Kawaguchi, R. Akasaka, T. Terada, S. Kuramitsu, M. Shirouzu, S. Yokoyama
Crystal Structure Of The Conserved Protein Ttha0727 From Thermus Thermophilus Hb8 At 1. 9 A Resolution: A Cmd Family Member Distinct From Carboxymuconolactone Decarboxylase (Cmd) And Ahpd
Protein Sci. V. 15 1187 2006
PubMed-ID: 16597838  |  Reference-DOI: 10.1110/PS.062148506

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN TTHA0727
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PHCEH
    Expression System Strain: B834(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: TTHA0727
    Organism Scientific: THERMUS THERMOPHILUS
    Organism Taxid: 300852
    Strain: HB8

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit : ABC
Biological Unit 1 (2x): ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 11)

Asymmetric Unit (1, 11)
No.NameCountTypeFull Name
1MSE11Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 22)
No.NameCountTypeFull Name
1MSE22Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2CWQ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2CWQ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2CWQ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2CWQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2CWQ)

(-) Exons   (0, 0)

(no "Exon" information available for 2CWQ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:126
 aligned with Q5SMF5_THET8 | Q5SMF5 from UniProtKB/TrEMBL  Length:117

    Alignment length:126
                                     1                                                                                                                    
                                     1        11        21        31        41        51        61        71        81        91       101       111      
         Q5SMF5_THET8     - ---------MDRTHERVLQAMAENLGEGLPRAIPLLAEKAPGLLLEHGRSWTYAMPEKGALDEKTRTLILLGIALATGSEACVKAMAHRAKRLGLSKEALLETLKIARQAQANAVLGHAAPLLEVL 117
               SCOP domains ---------d2cwqa1 A:1-117 Hypothetical protein TTHA0727                                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhhhh..hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2cwq A  -9 SGLVPRGSHmDRTHERVLQAmAENLGEGLPRAIPLLAEKAPGLLLEHGRSWTYAmPEKGALDEKTRTLILLGIALATGSEACVKAmAHRAKRLGLSKEALLETLKIARQAQANAVLGHAAPLLEVL 117
                                    |1        11|       21        31        41    |   51        61        71     |  81        91       101       111      
                                   -1|         12-MSE                            46-MSE                         77-MSE                                    
                                     1-MSE                                                                                                                


Chain B from PDB  Type:PROTEIN  Length:126
 aligned with Q5SMF5_THET8 | Q5SMF5 from UniProtKB/TrEMBL  Length:117

    Alignment length:126
                                     1                                                                                                                    
                                     1        11        21        31        41        51        61        71        81        91       101       111      
         Q5SMF5_THET8     - ---------MDRTHERVLQAMAENLGEGLPRAIPLLAEKAPGLLLEHGRSWTYAMPEKGALDEKTRTLILLGIALATGSEACVKAMAHRAKRLGLSKEALLETLKIARQAQANAVLGHAAPLLEVL 117
               SCOP domains d2cwqb_ B: Hypothetical protein TTHA0727                                                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhhhh..hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2cwq B  -9 SGLVPRGSHmDRTHERVLQAmAENLGEGLPRAIPLLAEKAPGLLLEHGRSWTYAmPEKGALDEKTRTLILLGIALATGSEACVKAmAHRAKRLGLSKEALLETLKIARQAQANAVLGHAAPLLEVL 117
                                    |1        11|       21        31        41    |   51        61        71     |  81        91       101       111      
                                   -1|         12-MSE                            46-MSE                         77-MSE                                    
                                     1-MSE                                                                                                                


Chain C from PDB  Type:PROTEIN  Length:112
 aligned with Q5SMF5_THET8 | Q5SMF5 from UniProtKB/TrEMBL  Length:117

    Alignment length:112
                                    15        25        35        45        55        65        75        85        95       105       115  
         Q5SMF5_THET8     6 ERVLQAMAENLGEGLPRAIPLLAEKAPGLLLEHGRSWTYAMPEKGALDEKTRTLILLGIALATGSEACVKAMAHRAKRLGLSKEALLETLKIARQAQANAVLGHAAPLLEVL 117
               SCOP domains d2cwqc_ C: Hypothetical protein TTHA0727                                                                         SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------- Transcript
                 2cwq C   6 ERVLQAmAENLGEGLPRAIPLLAEKAPGLLLEHGRSWTYAmPEKGALDEKTRTLILLGIALATGSEACVKAmAHRAKRLGLSKEALLETLKIARQAQANAVLGHAAPLLEVL 117
                                  | 15        25        35        45|       55        65        75 |      85        95       105       115  
                                 12-MSE                            46-MSE                         77-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2CWQ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2CWQ)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (Q5SMF5_THET8 | Q5SMF5)
molecular function
    GO:0051920    peroxiredoxin activity    Catalysis of the reaction: 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
biological process
    GO:0098869    cellular oxidant detoxification    Any process carried out at the cellular level that reduces or removes the toxicity superoxide radicals or hydrogen peroxide.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2cwq)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2cwq)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2cwq
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5SMF5_THET8 | Q5SMF5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q5SMF5_THET8 | Q5SMF5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2CWQ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2CWQ)