|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2CPS) |
Sites (0, 0)| (no "Site" information available for 2CPS) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2CPS) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2CPS) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2CPS) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2CPS) |
Exons (0, 0)| (no "Exon" information available for 2CPS) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:50 aligned with CAPSD_BPM13 | P69541 from UniProtKB/Swiss-Prot Length:73 Alignment length:50 33 43 53 63 73 CAPSD_BPM13 24 AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS 73 SCOP domains d2cpsa_ A: SCOP domains CATH domains 2cpsA00 A:1-50 [code=1.20.5.80, no name defined] CATH domains Pfam domains -------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------- PROSITE Transcript -------------------------------------------------- Transcript 2cps A 1 AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS 50 10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2CPS) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (CAPSD_BPM13 | P69541)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|