|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2COP) |
Sites (0, 0)| (no "Site" information available for 2COP) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2COP) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2COP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2COP) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2COP) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:109 aligned with ACBD6_HUMAN | Q9BR61 from UniProtKB/Swiss-Prot Length:282 Alignment length:135 22 32 42 52 62 72 82 92 102 112 122 132 142 ACBD6_HUMAN 13 GDSGGELSSGDDSGEVEFPHSPEIEETSCLAELFEKAAAHLQGLIQVASREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTGFGGPVIS 147 SCOP domains --------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----------------------------ACB_2 PDB: A:8-93 UniProt: 42-127 -------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript 2cop A 1 GSSG---SSG-------------------LAELFEKAAAHLQGLIQVASREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEAS----GPSSG 109 | | 7 - 8 18 28 38 48 58 68 78 88 98 | -| 4 5 7 8 104 105
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2COP) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2COP) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2COP) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (ACBD6_HUMAN | Q9BR61)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|