|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2CO9) |
Sites (0, 0)| (no "Site" information available for 2CO9) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2CO9) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2CO9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2CO9) |
PROSITE Motifs (1, 1)| NMR Structure (1, 1) |
Exons (0, 0)| (no "Exon" information available for 2CO9) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:102 aligned with TOX_MOUSE | Q66JW3 from UniProtKB/Swiss-Prot Length:526 Alignment length:157 218 228 238 248 258 268 278 288 298 308 318 328 338 348 358 TOX_MOUSE 209 GSKSATPSPSSSVHEDECEDASKINGGEKRPASDMGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYTDPVDVKTSQPPQLVNSKPSVFHGPSQA 365 SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------HMG_BOX_2 PDB: A:18-86 UniProt: 261-329 ------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2co9 A 1 GS-----SGSS------------------------GKK------KKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYTD--------------------SGPSSG 102 | | 5| - - | | - | 15 25 35 45 55 65 75 85 95| - - | 2 3 6 7 9 10 96 97
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2CO9) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2CO9) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2CO9) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (TOX_MOUSE | Q66JW3)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|