|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2C34) |
Sites (0, 0)| (no "Site" information available for 2C34) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2C34) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2C34) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2C34) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2C34) |
Exons (0, 0)| (no "Exon" information available for 2C34) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:116 aligned with Q868H1_LEIME | Q868H1 from UniProtKB/TrEMBL Length:113 Alignment length:116 1 | 7 17 27 37 47 57 67 77 87 97 107 Q868H1_LEIME - ---MIAPLSVKDNDKWVDTHVGKTTEIHLKGNPTTGYMWTRVGFVGKDVLSDEILEVVCKYTPTPSSTPMVGVGGIYVVLVKPRKRGHHTLELVYTRPFEGIKPENERYTLHLNVK 113 SCOP domains ---d2c34a1 A:1-113 Inhibitor of cysteine peptidases, ICP SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------- Transcript 2c34 A -2 GSHMIAPLSVKDNDKWVDTHVGKTTEIHLKGNPTTGYMWTRVGFVGKDVLSDEILEVVCKYTPTPSSTPMVGVGGIYVVLVKPRKRGHHTLELVYTRPFEGIKPENERYTLHLNVK 113 7 17 27 37 47 57 67 77 87 97 107
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2C34) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2C34) |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2C34)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|