Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  X-RAY STRUCTURE OF BIOTIN BINDING PROTEIN FROM CHICKEN
 
Authors :  V. P. Hytonen, E. A. Niskanen, J. A. E. Maatta, J. Huuskonen, K. J. Helttunen, K. K. Halling, J. P. Slotte, H. R. Nordlund, K. Rissanen, M. S. Johnson, T. A. Salminen, M. S. Kulomaa, O. H. Laitinen, T. T. Airenne
Date :  19 Sep 05  (Deposition) - 13 Feb 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.75
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Biotin Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  V. P. Hytonen, J. A. E. Maatta, E. A. Niskanen, J. Huuskonen, K. J. Helttunen, K. K. Halling, H. R. Nordlund, K. Rissanen, M. S. Johnson, T. A. Salminen, M. S. Kulomaa, O. H. Laitinen, T. T. Airenne
Structure And Characterization Of A Novel Chicken Biotin-Binding Protein A (Bbp-A).
Bmc Struct. Biol. V. 7 8 2007
PubMed-ID: 17343730  |  Reference-DOI: 10.1186/1472-6807-7-8

(-) Compounds

Molecule 1 - BIOTIN BINDING PROTEIN A
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonCHICKEN
    Organism ScientificGALLUS GALLUS
    Organism Taxid9031

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1BSO2Ligand/IonBIOTIN-D-SULFOXIDE
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1BSO4Ligand/IonBIOTIN-D-SULFOXIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:12 , LEU A:14 , SER A:16 , TYR A:33 , THR A:35 , VAL A:37 , THR A:38 , ALA A:39 , TRP A:71 , SER A:76 , THR A:78 , TRP A:98 , LEU A:100 , ASN A:119 , HOH A:2114 , TRP B:111BINDING SITE FOR RESIDUE BSO A1125
2AC2SOFTWARETRP A:111 , ASN B:12 , LEU B:14 , SER B:16 , TYR B:33 , THR B:35 , VAL B:37 , THR B:38 , ALA B:39 , TRP B:71 , SER B:76 , THR B:78 , TRP B:98 , LEU B:100 , ASN B:119 , HOH B:2098BINDING SITE FOR RESIDUE BSO B1125

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:4 -A:84
2B:4 -B:84

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2C1S)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2C1S)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2C1S)

(-) Exons   (0, 0)

(no "Exon" information available for 2C1S)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:123
                                                                                                                                                           
               SCOP domains d2c1sa_ A: automated matches                                                                                                SCOP domains
               CATH domains 2c1sA00 A:2-124  [code=2.40.128.30, no name defined]                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeee....eeee.......eeeeeee............eeeeeee...........eeeeee......eeeeeeeeee.....eeeeeeeeee....hhhhhhh.eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 2c1s A   2 RKCELQGLWRNELGSNMTISALDVAGTFSGSYQTAVTATNKQILVSPLKGAQQPPGTKGQQPTFGFTVQWQFADSTTVFVGQCFVDRRGKEMLEMAWLLREEVPSRKDTWKATRVGTNVFTRV 124
                                    11        21        31        41        51        61        71        81        91       101       111       121   

Chain B from PDB  Type:PROTEIN  Length:123
                                                                                                                                                           
               SCOP domains d2c1sb_ B: automated matches                                                                                                SCOP domains
               CATH domains 2c1sB00 B:2-124  [code=2.40.128.30, no name defined]                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeee....eeee.......eeeeeee............eeeeeee..........eeeeeee......eeeeeeeeee.....eeeeeeeeee....hhhhhhh.eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 2c1s B   2 RKCELQGLWRNELGSNMTISALDVAGTFSGSYQTAVTATNKQILVSPLKGAQQPPGTKGQQPTFGFTVQWQFADSTTVFVGQCFVDRRGKEMLEMAWLLREEVPSRKDTWKATRVGTNVFTRV 124
                                    11        21        31        41        51        61        71        81        91       101       111       121   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2C1S)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2C1S)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BSO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2c1s)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2c1s
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2C1S)

(-) Related Entries Specified in the PDB File

2c1q X-RAY STRUCTURE OF BIOTIN BINDING PROTEIN FROM CHICKEN