2BTU - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF PHOSPHORIBOSYLFORMYLGLYCINAMIDINE CYCLO-LIGASE FROM BACILLUS ANTHRACIS AT 2.3A RESOLUTION.

Authors :   O. V. Moroz, E. V. Blagova, V. M. Levdikov, M. J. Fogg, A. A. Lebedev, J. A. Brannigan, A. J. Wilkinson, K. S. Wilson

Date :   07 Jun 05 (Deposition) - 23 Aug 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.31

Chains :   Asym./Biol. Unit : A,B

Keywords :   Synthase, Purm, De Novo Purine Biosynthesis, Air Synthase Family, Spine, Synthetase, Fgar Amidotransferase, Novel Fold, Structural Proteomics In Europe, Structural Genomics (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   O. V. Moroz, E. V. Blagova, V. M. Levdikov, M. J. Fogg, A. A. Lebedev, J. A. Brannigan, A. J. Wilkinson, K. S. Wilson
Crystal Structure Of Phosphoribosylformylglycinamidine Cyclo-Ligase From Bacillus Anthracis At 2. 3A Resolution.
To Be Published
PubMed: search

Molecule 1 - PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE
	Chains	:	A, B
	EC Number	:	6.3.3.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET-YSBLIC
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Organism Scientific	:	BACILLUS ANTHRACIS
	Organism Taxid	:	1392
	Synonym	:	PHOSPHORIBOSYLFORMYLGLYCINAMIDINE CYCLO-LIGASE AIRS, PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE, AIR SYNTHASE

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2BTU)

(no "Site" information available for 2BTU)

(no "SS Bond" information available for 2BTU)

(no "Cis Peptide Bond" information available for 2BTU)

(no "SAP(SNP)/Variant" information available for 2BTU)

(no "PROSITE Motif" information available for 2BTU)

(no "Exon" information available for 2BTU)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:322
 aligned with PUR5_BACAN | Q81ZH0 from UniProtKB/Swiss-Prot  Length:346

    Alignment length:329
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332         
           PUR5_BACAN    13 EAGYEAVSRMKKHVQTTMRKEVLGGLGGFGGMFDLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLDYIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDKKKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELSLDRIYGRLELPLGEELLKPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWKIQPIFSLLQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGVTFN 341
               SCOP domains d2btua1 A:13-167 automate   d matches                                                                                                                      d2btua2 A:168-341 automated matches                                                                                                                                            SCOP domains
               CATH domains 2btuA01 A:13-167  [code=3   .30.1330.10, no name defined]                                                                                                  2btuA02 A:168-341 Phosphoribosyl-amin    oimidazole Synthetase; Chain A, domain 2                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhh...ee..---...eee........eeeeeeeee...hhhhhhhhh...hhhhhhhhhhhhhhhh...eeeeeeeeeee...hhhhhhhhhhhhhhhhhhhh.eeeeeeeee..........eeeeeeeeeee..............eeeeee.......hhhhhhhhhhh....----.......hhhhhhh.....hhhhhhhhhhhh.....ee...hhhhhhhhhhh...eeeeee......hhhhhhhhhhhh.hhhhhh......eeeeeee...hhhhhhhhhhhhh..eeeeeeeee...eeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2btu A  13 EAGYEAVSRMKKHVQTTMRKEVLGG---FGGMFDLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLDYIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDKKKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGEL----IYGRLELPLGEELLKPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWKIQPIFSLLQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGVTFN 341
                                    22        32    |   42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202 |    |212       222       232       242       252       262       272       282       292       302       312       322       332         
                                                   37  41                                                                                                                                                                204  209

Chain B from PDB  Type:PROTEIN  Length:307
 aligned with PUR5_BACAN | Q81ZH0 from UniProtKB/Swiss-Prot  Length:346

    Alignment length:327
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       
           PUR5_BACAN    12 IEAGYEAVSRMKKHVQTTMRKEVLGGLGGFGGMFDLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLDYIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDKKKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELSLDRIYGRLELPLGEELLKPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWKIQPIFSLLQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGV 338
               SCOP domains d2btub1 B:12-167 automated matches                                                                                                                          d2btub2 B:168-338 automated matches                                                                                                                                         SCOP domains
               CATH domains 2btuB01 B:12-167  [code=3.30.1330.10     , no name d efined]                                                                                                2btuB02 B:168-338 Phosphoribosyl-am             inoimidazole Synthetase; Chain A, domain 2                                                                                  CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh...hhhhhh...ee........eee.-----..eeeeeeee.-..hhhhhhhhh...hhhhhhhhhhhhhhhh...eeeeeeeeeee...hhhhhhhhhhhhhhhhhhhh.eeeeeeeee.....-...eeeeeeeeeeee.hhh..........eeeeee.......hhhhhhhhh....-------------hhhhhhh.....hhhhhhhhhhhh...eeee...hhhhhhhhhhh....eeee.......hhhhhhhhhhh..hhhhhh......eeeeeee...hhhhhhhhhhh......eeeeee..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2btu B  12 IEAGYEAVSRMKKHVQTTMRKEVLGGLGGFGGMFDL-----EEPVLVSGTDG-GTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLDYIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMY-TEEYDLAGFTVGIVDKKKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDG-------------PLGEELLKPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWKIQPIFSLLQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGV 338
                                    21        31        41     |   - |      61 | |    71        81        91       101       111       121       131       141    | |151       161       171       181       191       201|        -    |  221       231       241       251       261       271       281       291       301       311       321       331       
                                                              47    53        63 |                                                                              146 |                                                   202           216                                                                                                                          
                                                                                65                                                                                148

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "Pfam Domain" information available for 2BTU)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (PUR5_BACAN | Q81ZH0)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016874	ligase activity	Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0004641	phosphoribosylformylglycinamidine cyclo-ligase activity	Catalysis of the reaction: 2-(formamido)-N(1)-(5-phospho-D-ribosyl)acetamidine + ATP = 5-amino-1-(5-phospho-D-ribosyl)imidazole + ADP + 2 H(+) + phosphate.
biological process
	GO:0006189	'de novo' IMP biosynthetic process	The chemical reactions and pathways resulting in the formation of IMP, inosine monophosphate, by the stepwise assembly of a purine ring on ribose 5-phosphate.
	GO:0006164	purine nucleotide biosynthetic process	The chemical reactions and pathways resulting in the formation of a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2btu)

	Sites
(no "Sites" information available for 2btu)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2btu)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2btu
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PUR5_BACAN \| Q81ZH0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	6.3.3.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PUR5_BACAN \| Q81ZH0
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2BTU)

(no "Related Entries Specified in the PDB File" available for 2BTU)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (7, 7)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File