Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  NADPH:FMN OXIDOREDUCTASE FROM VIBRIO HARVEYI COMPLEXED WITH NAD+
 
Authors :  J. J. Tanner, S. -C. Tu, K. L. Krause
Date :  23 Jul 98  (Deposition) - 10 Sep 99  (Release) - 09 May 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.08
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Oxidoreductase, Frp (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. J. Tanner, S. C. Tu, L. J. Barbour, C. L. Barnes, K. L. Krause
Unusual Folded Conformation Of Nicotinamide Adenine Dinucleotide Bound To Flavin Reductase P.
Protein Sci. V. 8 1725 1999
PubMed-ID: 10493573
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FLAVIN REDUCTASE
    ChainsA, B
    EC Number1.6.99.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainJM109
    Expression System Taxid562
    Organism ScientificVIBRIO HARVEYI
    Organism Taxid669
    StrainJM109

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric/Biological Unit (2, 3)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE
2NAD1Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:11 , ARG A:12 , SER A:13 , ARG A:15 , GLN A:67 , TYR A:69 , VAL A:127 , TYR A:128 , ILE A:129 , GLY A:130 , GLY A:131 , LYS A:167 , ARG A:169 , HOH A:314 , HOH A:315 , HOH A:316 , SER B:38 , SER B:39 , SER B:40 , MET B:42 , ASP B:107 , ILE B:110BINDING SITE FOR RESIDUE FMN A 241
2AC2SOFTWARESER A:38 , SER A:39 , SER A:40 , MET A:42 , ASP A:107 , HIS B:11 , ARG B:12 , SER B:13 , ARG B:15 , GLN B:67 , TYR B:69 , VAL B:127 , TYR B:128 , ILE B:129 , GLY B:130 , GLY B:131 , LYS B:167 , ARG B:169 , NAD B:243 , HOH B:329 , HOH B:337BINDING SITE FOR RESIDUE FMN B 241
3AC3SOFTWARESER A:41 , ARG B:15 , GLY B:65 , GLN B:67 , TYR B:69 , GLY B:130 , GLY B:131 , ASN B:134 , ARG B:225 , FMN B:241 , HOH B:402BINDING SITE FOR RESIDUE NAD B 243

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2BKJ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2BKJ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2BKJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2BKJ)

(-) Exons   (0, 0)

(no "Exon" information available for 2BKJ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:230
 aligned with FRP_VIBHA | Q56691 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:239
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231         
            FRP_VIBHA     2 NNTIETILAHRSIRKFTAVPITDEQRQTIIQAGLAASSSSMLQVVSIVRVTDSEKRNELAQFAGNQAYVESAAEFLVFCIDYQRHATINPDVQADFTELTLIGAVDSGIMAQNCLLAAESMGLGGVYIGGLRNSAAQVDELLGLPENSAVLFGMCLGHPDQNPEVKPRLPAHVVVHENQYQELNLDDIQSYDQTMQAYYASRTSNQKLSTWSQEVTGKLAGESRPHILPYLNSKGLAKR 240
               SCOP domains d2bkja_ A: Flavin reductase P (NADPH:FMN oxidoreductase)                                                                                                                                                                                        SCOP domains
               CATH domains 2bkjA00 A:2-240 NADH Oxidase                                                                                                                                                                                                                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh.............hhhhhhhhhhhhh.........eeeeee..hhhhhhhhhhh...hhhhh..eeeeeeeehhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhh..eeeeehhhhh.hhhhhhhh.....eeeeeeeeee.............hhhheee.......hhhhhhhhhhhhhh.---------..hhhhhhhhhh.....hhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2bkj A   2 NNTIETILAHRSIRKFTAVPITDEQRQTIIQAGLAASSSSMLQVVSIVRVTDSEKRNELAQFAGNQAYVESAAEFLVFCIDYQRHATINPDVQADFTELTLIGAVDSGIMAQNCLLAAESMGLGGVYIGGLRNSAAQVDELLGLPENSAVLFGMCLGHPDQNPEVKPRLPAHVVVHENQYQELNLDDIQSYDQTMQAYY---------STWSQEVTGKLAGESRPHILPYLNSKGLAKR 240
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191        |-       211       221       231         
                                                                                                                                                                                                                                200       210                              

Chain B from PDB  Type:PROTEIN  Length:230
 aligned with FRP_VIBHA | Q56691 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:239
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231         
            FRP_VIBHA     2 NNTIETILAHRSIRKFTAVPITDEQRQTIIQAGLAASSSSMLQVVSIVRVTDSEKRNELAQFAGNQAYVESAAEFLVFCIDYQRHATINPDVQADFTELTLIGAVDSGIMAQNCLLAAESMGLGGVYIGGLRNSAAQVDELLGLPENSAVLFGMCLGHPDQNPEVKPRLPAHVVVHENQYQELNLDDIQSYDQTMQAYYASRTSNQKLSTWSQEVTGKLAGESRPHILPYLNSKGLAKR 240
               SCOP domains d2bkjb_ B: Flavin reductase P (NADPH:FMN oxidoreductase)                                                                                                                                                                                        SCOP domains
               CATH domains 2bkjB00 B:2-240 NADH Oxidase                                                                                                                                                                                                                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh.............hhhhhhhhhhhhh.........eeeeee..hhhhhhhhhhh...hhhhh..eeeeeeeehhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhh..eeeeehhhhh.hhhhhhhh.....eeeeeeeeee.............hhhheee.......hhhhhhhhhhhhhh.---------..hhhhhhhhhh.....hhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2bkj B   2 NNTIETILAHRSIRKFTAVPITDEQRQTIIQAGLAASSSSMLQVVSIVRVTDSEKRNELAQFAGNQAYVESAAEFLVFCIDYQRHATINPDVQADFTELTLIGAVDSGIMAQNCLLAAESMGLGGVYIGGLRNSAAQVDELLGLPENSAVLFGMCLGHPDQNPEVKPRLPAHVVVHENQYQELNLDDIQSYDQTMQAYY---------STWSQEVTGKLAGESRPHILPYLNSKGLAKR 240
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191        |-       211       221       231         
                                                                                                                                                                                                                                200       210                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2BKJ)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (FRP_VIBHA | Q56691)
molecular function
    GO:0052873    FMN reductase (NADPH) activity    Catalysis of the reaction: FMNH2 + NADP+ = FMN + NADPH + 2 H+.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0008218    bioluminescence    The production of light by certain enzyme-catalyzed reactions in cells.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2bkj)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2bkj
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FRP_VIBHA | Q56691
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.6.99.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FRP_VIBHA | Q56691
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FRP_VIBHA | Q566911bkj

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2BKJ)