|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)| Asymmetric Unit (2, 3) Biological Unit 1 (2, 6) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2BDT) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2BDT) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2BDT) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2BDT) |
Exons (0, 0)| (no "Exon" information available for 2BDT) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:172 aligned with Q9K6P2_BACHD | Q9K6P2 from UniProtKB/TrEMBL Length:176 Alignment length:176 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 Q9K6P2_BACHD 1 MKKLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHMVVGGYRPPWESDELLALTWKNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDALRKKDEQMGERCLELVEEFESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFIFC 176 SCOP domains d2bdta1 A:1-176 Hypothetical protein BH3686 SCOP domains CATH domains -2bdtA00 A:2-176 P-loop containing nucleotide triphosphate hydrolases CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2bdt A 1 mKKLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHmVVGGYRPPWESDELLALTWKNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDALRKK----GERCLELVEEFESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFIFC 176 | 10 20 30 40 50 60 70 80 90 100 110 120 | 130 140 150 160 170 | 40-MSE 124 129 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2BDT) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2BDT)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|