2BBH - JenaLib

Title :   X-RAY STRUCTURE OF T.MARITIMA CORA SOLUBLE DOMAIN

Authors :   V. V. Lunin, E. Dobrovetsky, G. Khutoreskaya, A. Bochkarev, M. E. Magui A. M. Edwards, C. M. Koth, Structural Genomics Consortium (Sgc)

Date :   17 Oct 05 (Deposition) - 13 Dec 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.85

Chains :   Asym. Unit : A
Biol. Unit 1: A  (1x)
Biol. Unit 2: A  (2x)

Keywords :   Transporter, Mg, Membrane, Structural Genomics, Structural Genomics Consortium, Sgc, Metal Transport-Membrane Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   V. V. Lunin, E. Dobrovetsky, G. Khutoreskaya, R. Zhang, A. Joachimiak D. A. Doyle, A. Bochkarev, M. E. Maguire, A. M. Edwards, C. M. Koth
Crystal Structure Of The Cora Mg2+ Transporter.
Nature V. 440 833 2006
PubMed-ID: 16598263 | Reference-DOI: 10.1038/NATURE04642

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 9)

Sites (6, 6)

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LYS A:22 , VAL A:99 , LYS A:133 , ARG A:165 , TYR A:171 , GLU A:230 , HOH A:504 , HOH A:506 , HOH A:522 , HOH A:597	BINDING SITE FOR RESIDUE DMU A 401
2	AC2	SOFTWARE	LYS A:111 , PHE A:113 , SER A:124 , VAL A:178 , TYR A:181 , THR A:224 , HOH A:494 , HOH A:513 , HOH A:529 , HOH A:530 , HOH A:585	BINDING SITE FOR RESIDUE DMU A 402
3	AC3	SOFTWARE	GLU A:38 , SER A:57 , HIS A:83 , HIS A:94 , GLN A:95 , ARG A:96 , PRO A:97 , PHE A:101 , GLU A:103 , LYS A:111 , LEU A:228 , HOH A:530 , HOH A:536 , HOH A:540 , HOH A:562 , HOH A:585	BINDING SITE FOR RESIDUE DMU A 403
4	AC4	SOFTWARE	TYR A:171 , ASP A:175 , ASP A:179 , PHE A:182 , HOH A:509 , HOH A:543	BINDING SITE FOR RESIDUE DMU A 404
5	AC5	SOFTWARE	MSE A:112 , GLU A:125 , GLN A:140 , LYS A:142 , GLY A:144	BINDING SITE FOR RESIDUE NA A 301
6	AC6	SOFTWARE	ASP A:89 , HOH A:425 , HOH A:437 , HOH A:573 , HOH A:613 , HOH A:619	BINDING SITE FOR RESIDUE MG A 302

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:223
 aligned with CORA_THEMA | Q9WZ31 from UniProtKB/Swiss-Prot  Length:351

    Alignment length:232
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242  
           CORA_THEMA    13 PPGTLVYTGKYREDFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELRKTIWPLREVLSSLYRDVPPLIE 244
               SCOP domains d2bbha1 A:13-244 Magnesium transport protein CorA, soluble domain                                                                                                                                                                        SCOP domains
               CATH domains 2bbhA01 A:13-165 CorA soluble domain-like                                                                                                                ----------------------------------       -------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeeeeeee..eeeeeee.hhhhhhhhhhh...eeeeee...hhhhhhhhhhhhh.hhhhhhhhhh.....eeee...eeeeeeeeee...--...eeeeeeeeee..eeeeee......hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.-------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2bbh A  13 PPGTLVYTGKYREDFEIEVmNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGTHPLVLEDILNVHQRPKVEFFENYVFIVLKmFTYDK--HELESEQVSLILTKNCVLmFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEV-------TVQRTHQLKRNLVELRKTIWPLREVLSSLYRDVPPLIE 244
                                    22        32        42        52        62        72        82        92       102       112    |  122       132     | 142       152       162       172       182       192      |  -    |  212       222       232       242  
                                              32-MSE                                                                         112-MSE7  |               138-MSE                                                      199     207                                     
                                                                                                                                     120

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (18, 18)

Asymmetric Unit(hide GO term definitions)

Chain A (CORA_THEMA | Q9WZ31)

molecular function
	GO:0050897	cobalt ion binding	Interacting selectively and non-covalently with a cobalt (Co) ion.
	GO:0015087	cobalt ion transmembrane transporter activity	Enables the transfer of cobalt (Co) ions from one side of a membrane to the other.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0015095	magnesium ion transmembrane transporter activity	Enables the transfer of magnesium (Mg) ions from one side of a membrane to the other.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0046873	metal ion transmembrane transporter activity	Enables the transfer of metal ions from one side of a membrane to the other.
biological process
	GO:0006824	cobalt ion transport	The directed movement of cobalt (Co) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:1903830	magnesium ion transmembrane transport	The directed movement of magnesium ion across a membrane.
	GO:0015693	magnesium ion transport	The directed movement of magnesium (Mg) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0030001	metal ion transport	The directed movement of metal ions, any metal ion with an electric charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0051260	protein homooligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of identical component monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		DMU	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Glu A:198 - Val A:199	[ RasMol ]
		His A:120 - Glu A:121	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2bbh
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CORA_THEMA \| Q9WZ31
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description