|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 11)| Asymmetric Unit (4, 11) Biological Unit 1 (3, 20) |
Sites (7, 7)
Asymmetric Unit (7, 7)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2B8M) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2B8M) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2B8M) |
Exons (0, 0)| (no "Exon" information available for 2B8M) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:109 aligned with Y764_METJA | Q58174 from UniProtKB/Swiss-Prot Length:116 Alignment length:109 1 | 9 19 29 39 49 59 69 79 89 99 Y764_METJA - -MIEKVYEFKRDAKTKVVEKLVNTEHVQINHIVLPRGEQMPKHYSNSYVHLIIIKGEMTLTLEDQEPHNYKEGNIVYVPFNVKMLIQNINSDILEFFVVKAPHPKKLNA 108 SCOP domains -d2b8ma1 A:1-108 Hypothetical protein MJ0764 SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------- Transcript 2b8m A 0 GmIEKVYEFKRDAKTKVVEKLVNTEHVQINHIVLPRGEQmPKHYSNSYVHLIIIKGEmTLTLEDQEPHNYKEGNIVYVPFNVKmLIQNINSDILEFFVVKAPHPKKLNA 108 | 9 19 29 39 49 |59 69 79 | 89 99 | 39-MSE 57-MSE 83-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2B8M) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2B8M) |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A (Y764_METJA | Q58174)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|