|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2B3I) |
Cis Peptide Bonds (2, 38)
NMR Structure
|
|||||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2B3I) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2B3I) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:97 aligned with PLAS_PROHO | P50057 from UniProtKB/Swiss-Prot Length:131 Alignment length:97 44 54 64 74 84 94 104 114 124 PLAS_PROHO 35 ATVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE 131 SCOP domains d2b3ia_ A: Plastocyanin SCOP domains CATH domains 2b3iA00 A:1-97 Cupredoxins - blue copper proteins CATH domains Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------COPPER_BLUE ------- PROSITE Transcript ------------------------------------------------------------------------------------------------- Transcript 2b3i A 1 ASVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE 97 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2B3I) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (PLAS_PROHO | P50057)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|