Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ENTEROCHELIN ESTERASE FROM SHIGELLA FLEXNERI ENTEROCHELIN ESTERASE
 
Authors :  Y. Kim, N. Maltseva, I. Dementieva, P. Quartey, D. Holzle, F. Collart, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  16 Sep 05  (Deposition) - 01 Nov 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.95
Chains :  Asym./Biol. Unit :  A
Keywords :  Alpha-Beta-Alpha-Sandwich, Structural Genomics, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Kim, N. Maltseva, I. Dementieva, P. Quartey, D. Holzle, F. Collart, A. Joachimiak
Crystal Structure Of Enterochelin Esterase From Shigella Flexneri Enterochelin Esterase
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ENTEROCHELIN ESTERASE
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PMCSG7
    Expression System Strain: BL21DE3
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: SHIGELLA FLEXNERI 2A STR. 2457T
    Organism Taxid: 198215
    Strain: 2A STR. 2457T

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric/Biological Unit (2, 8)
No.NameCountTypeFull Name
1MSE7Mod. Amino AcidSELENOMETHIONINE
2TLA1Ligand/IonL(+)-TARTARIC ACID

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPRO A:130 , GLN A:131 , HOH A:531BINDING SITE FOR RESIDUE TLA A 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2B20)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ser A:106 -Pro A:107
2Trp A:310 -Pro A:311

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2B20)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2B20)

(-) Exons   (0, 0)

(no "Exon" information available for 2B20)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:391
 aligned with Q83SB9_SHIFL | Q83SB9 from UniProtKB/TrEMBL  Length:400

    Alignment length:395
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392     
         Q83SB9_SHIFL     3 ALKVGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTDHHQNSQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPSPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVTAEERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLFH 397
               SCOP domains d2b20a1 A:3-150 Enterochelin esterase                                                                                                               d2b20a2 A:151-397 Enterochelin esterase,   catalytic domain                                                                                                                                                                                             SCOP domains
               CATH domains 2b20A01 A:3-144 Immunoglobulins                                                                                                               2b20A02 A:145-397  [code=3.40.50.1820, no name   defined]                                                                                                                                                                                                     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhh....eeee....eeeeeeeee............eeeeee..hhhhh.--.....ee.....eeeeeeeee...eeeeeeeee...........hhhhhhhhhhhhhhhh........eee.....eeeeee....................eeeeeee....eeeeeeeee.....--...eeeeehhhhhhhh..hhhhhhhhhhh......eeeee...hhhhhhhhh..hhhhhhhhhhhhhhhhhhhh....hhhh.eeeeehhhhhhhhhhhhhh.....eeeee................hhhhhhh........eeeeeee...hhhhhhhhhhhhhhhhhhh.eeeeee....hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2b20 A   3 ALKVGSESWWQSKHGPEWQRLNDEmFEVTFWWRDPQGSEEYSTIKRVWVYITGVTDHHQ--QPQSmQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPSPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEmPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVT--ERPLAVLLDGEFWAQSmPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPmImRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLmQGLIDLWQPLFH 397
                                    12        22    |   32        42        52        |- |   |  72        82        92       102       112       122       132       142   |   152       162       172       182       | -|      202      |212       222       232       242       252       262       272       282       292       302       312       322       332       342    | |352       362       372       382  |    392     
                                                   27-MSE                            61 64   |                                                                           146-MSE                                     190  |             209-MSE                                                                                                                                   347-MSE                               385-MSE        
                                                                                            68-MSE                                                                                                                      193                                                                                                                                                         349-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2B20)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q83SB9_SHIFL | Q83SB9)
molecular function
    GO:0008849    enterochelin esterase activity    Catalysis of the reaction: enterobactin + 3 H2O = 3 N-23-dihydroxybenzoyl-L-serine + 3 H+.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
biological process
    GO:0006826    iron ion transport    The directed movement of iron (Fe) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TLA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:106 - Pro A:107   [ RasMol ]  
    Trp A:310 - Pro A:311   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2b20
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q83SB9_SHIFL | Q83SB9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q83SB9_SHIFL | Q83SB9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q83SB9_SHIFL | Q83SB9: 3c87 3c8d 3c8h

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2B20)