|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 6)| Asymmetric/Biological Unit (2, 6) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2AU5) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2AU5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2AU5) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2AU5) |
Exons (0, 0)| (no "Exon" information available for 2AU5) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:129 aligned with Q82ZV0_ENTFA | Q82ZV0 from UniProtKB/TrEMBL Length:136 Alignment length:133 1 | 9 19 29 39 49 59 69 79 89 99 109 119 129 Q82ZV0_ENTFA - -MLILSTEKEPNFEYEEITRSFLSNMLAFTRGHFTGDISHFSPIVLAEMEKDPNWLEEAAGGMQGVIVQSLLEDENFSSVEQLKGELARLIRLYFALAKDNLTENQESLYVDLFDKFTFLLLCSDEFIMYLDS 132 SCOP domains -d2au5 a1 A:1-132 Hypothetical protein EF2947 SCOP domains CATH domains 2au5A0 0 A:0-132 EF2947-like domains CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript 2au5 A 0 AmLILS----PNFEYEEITRSFLSNmLAFTRGHFTGDISHFSPIVLAEmEKDPNWLEEAAGGmQGVIVQSLLEDENFSSVEQLKGELARLIRLYFALAKDNLTENQESLYVDLFDKFTFLLLCSDEFImYLDS 132 | | -| 19 | 29 39 49 59 | 69 79 89 99 109 119 129 | 5 10 25-MSE 48-MSE 62-MSE 128-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2AU5) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2AU5)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|