|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (3, 5)
|
Asymmetric Unit (5, 5)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 2ATB) |
(no "SAP(SNP)/Variant" information available for 2ATB) |
(no "PROSITE Motif" information available for 2ATB) |
(no "Exon" information available for 2ATB) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:65 aligned with SCXA_LEIQH | P17728 from UniProtKB/Swiss-Prot Length:85 Alignment length:65 28 38 48 58 68 78 SCXA_LEIQH 19 SVRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCH 83 SCOP domains d2atba_ A: automated matches SCOP domains CATH domains 2atbA00 A:1-65 [code=3.30.30.10, no name defined] CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 2atb A 1 MVRDAYIADDVNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCR 65 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:65 aligned with SCXA_LEIQH | P17728 from UniProtKB/Swiss-Prot Length:85 Alignment length:65 28 38 48 58 68 78 SCXA_LEIQH 19 SVRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCH 83 SCOP domains d2atbb_ B: automated matches SCOP domains CATH domains 2atbB00 B:1-65 [code=3.30.30.10, no name defined] CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 2atb B 1 MVRDAYIADDVNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCR 65 10 20 30 40 50 60
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 2ATB) |
Asymmetric Unit(hide GO term definitions) Chain A,B (SCXA_LEIQH | P17728)
|
|
|
|
|
|
|