|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (1, 4) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3QY3) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3QY3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3QY3) |
Exons (0, 0)| (no "Exon" information available for 3QY3) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:130 aligned with Q9I042_PSEAE | Q9I042 from UniProtKB/TrEMBL Length:134 Alignment length:130 14 24 34 44 54 64 74 84 94 104 114 124 134 Q9I042_PSEAE 5 QLLHTAHIPVRWGDMDSYGHVNNTLYFQYLEEARVAWFETLGIDLEGAAEGPVVLQSLHTYLKPVVHPATVVVELYAGRLGTSSLVLEHRLHTLEDPQGTYGEGHCKLVWVRHAENRSTPVPDSIRAAIA 134 SCOP domains d3qy3a1 A:5-134 Hypothetical protein PA2801 SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -----------------4HBT-3qy3A01 A:22-104 ------------------------------ Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript 3qy3 A 5 QLLHTAHIPVRWGDmDSYGHVNNTLYFQYLEEARVAWFETLGIDLEGAAEGPVVLQSLHTYLKPVVHPATVVVELYAGRLGTSSLVLEHRLHTLEDPQGTYGEGHCKLVWVRHAENRSTPVPDSIRAAIA 134 14 | 24 34 44 54 64 74 84 94 104 114 124 134 19-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0 ; only for superseded entry 2ALI: 1,1)| (no "CATH Domain" information available for 3QY3, only for superseded entry 2ALI replaced by 3QY3) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3QY3)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|