|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 6)| Asymmetric/Biological Unit (3, 6) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2AJ6) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2AJ6) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2AJ6) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2AJ6) |
Exons (0, 0)| (no "Exon" information available for 2AJ6) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:120 aligned with A0A0H3JUY4_S | A0A0H3JUY4 from UniProtKB/TrEMBL Length:147 Alignment length:120 1 | 8 18 28 38 48 58 68 78 88 98 108 118 A0A0H3JUY4_S - --MRTLNKDEHNYIKQIANIHETLLSQVESNYKCTKLSIALRYEMICSRLEHTNDKIYIYENEGQLIAFIWGHFSNEKSMVNIELLYVEPQFRKLGIATQLKIALEKWAKTMNAKRISNT 118 SCOP domains --d2aj6a1 A:1-118 Hypothetical protein MW0638 SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript 2aj6 A -1 HHmRTLNKDEHNYIKQIANIHETLLSQVESNYKCTKLSIALRYEmICSRLEHTNDKIYIYENEGQLIAFIWGHFSNEKSmVNIELLYVEPQFRKLGIATQLKIALEKWAKTmNAKRISNT 118 | 8 18 28 38 | 48 58 68 78 88 98 108 | 118 | 43-MSE 78-MSE 110-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2AJ6) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2AJ6) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2AJ6)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|