Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  PURINE NUCLEOSIDE PHOSPHORYLASE FROM CALF SPLEEN
 
Authors :  A. V. Toms, W. Wang, Y. Li, B. Ganem, S. E. Ealick
Date :  28 Jul 05  (Deposition) - 25 Oct 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (3x)
Keywords :  Purine Nucleoside Phosphorylase, Multisubstrate Analog Inhibitor, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. V. Toms, W. Wang, Y. Li, B. Ganem, S. E. Ealick
Novel Multisubstrate Inhibitors Of Mammalian Purine Nucleoside Phosphorylase.
Acta Crystallogr. , Sect. D V. 61 1449 2005
PubMed-ID: 16239721  |  Reference-DOI: 10.1107/S0907444905025503
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PURINE NUCLEOSIDE PHOSPHORYLASE
    ChainsA
    EC Number2.4.2.1
    OrganSPLEEN
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    Other DetailsCALF SPLEEN PURINE NUCLEOSIDE PHOSPHORYLASE PURCHASED FROM SIGMA CO.
    SynonymINOSINE PHOSPHORYLASE, PNP

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (3x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 4)

Asymmetric Unit (4, 4)
No.NameCountTypeFull Name
11441Ligand/IonTRIS-HYDROXYMETHYL-METHYL-AMMONIUM
2MG1Ligand/IonMAGNESIUM ION
3P2G1Ligand/Ion(2S,4R,6R,6AS)-4-(2-AMINO-6-OXO-1,6-DIHYDROPURIN-9-YL)-6-(HYDROXYMETHYL)-TETRAHYDROFURO[3,4-D][1,3]DIOXOL-2-YLPHOSPHONIC ACID
4ZN1Ligand/IonZINC ION
Biological Unit 1 (2, 6)
No.NameCountTypeFull Name
11443Ligand/IonTRIS-HYDROXYMETHYL-METHYL-AMMONIUM
2MG-1Ligand/IonMAGNESIUM ION
3P2G3Ligand/Ion(2S,4R,6R,6AS)-4-(2-AMINO-6-OXO-1,6-DIHYDROPURIN-9-YL)-6-(HYDROXYMETHYL)-TETRAHYDROFURO[3,4-D][1,3]DIOXOL-2-YLPHOSPHONIC ACID
4ZN-1Ligand/IonZINC ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH A:2034 , HOH A:2055 , HOH A:2092 , HOH A:2093 , HOH A:2094 , HOH A:2095BINDING SITE FOR RESIDUE MG A 290
2AC2SOFTWAREHIS A:20 , HOH A:2096BINDING SITE FOR RESIDUE ZN A 291
3AC3SOFTWAREGLU A:52 , HOH A:2029 , HOH A:2037 , HOH A:2041 , HOH A:2057BINDING SITE FOR RESIDUE 144 A 292
4AC4SOFTWARESER A:33 , ARG A:84 , HIS A:86 , ASN A:115 , ALA A:116 , ALA A:117 , GLY A:118 , PHE A:159 , LEU A:195 , PHE A:200 , GLU A:201 , VAL A:217 , MET A:219 , SER A:220 , THR A:242 , ASN A:243 , VAL A:245 , HIS A:257 , VAL A:260 , HOH A:2027 , HOH A:2080BINDING SITE FOR RESIDUE P2G A 293

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2AI3)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Gly A:197 -Pro A:198
2Ile A:282 -Pro A:283

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2AI3)

(-) PROSITE Motifs  (1, 1)

Asymmetric Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PNP_MTAP_2PS01240 Purine and other phosphorylases family 2 signature.PNPH_BOVIN79-120  1A:79-120
Biological Unit 1 (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PNP_MTAP_2PS01240 Purine and other phosphorylases family 2 signature.PNPH_BOVIN79-120  3A:79-120

(-) Exons   (6, 6)

Asymmetric Unit (6, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSBTAT000000163461ENSBTAE00000133169chr10:26040769-26040670100PNPH_BOVIN1-33331A:3-3331
1.3ENSBTAT000000163463ENSBTAE00000420054chr10:26038796-26038627170PNPH_BOVIN33-90581A:33-90 (gaps)58
1.4ENSBTAT000000163464ENSBTAE00000408817chr10:26036665-26036562104PNPH_BOVIN90-124351A:90-12435
1.5ENSBTAT000000163465ENSBTAE00000427656chr10:26036357-26036182176PNPH_BOVIN125-183591A:125-18359
1.6ENSBTAT000000163466ENSBTAE00000404946chr10:26036090-26035900191PNPH_BOVIN183-247651A:183-24765
1.7ENSBTAT000000163467ENSBTAE00000133178chr10:26035106-26034471636PNPH_BOVIN247-318721A:247-284 (gaps)38

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:272
 aligned with PNPH_BOVIN | P55859 from UniProtKB/Swiss-Prot  Length:289

    Alignment length:282
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282  
           PNPH_BOVIN     3 NGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESQGKANHEEVLEAGKQAAQKLEQFVSLLMASIPV 284
               SCOP domains d2ai3a_ A: Purine nucleoside phosphorylase, PNP                                                                                                                                                                                                                                            SCOP domains
               CATH domains 2ai3A00 A:3-284  [code=3.40.50.1580, no name defined]                                                                                                                                                                                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh.....eeeee...hhhhhhhheeeeeee.hhh......------.eeeeeee..eeeeeee...hhhhh.hhhhhhhhhhhhhhh...eeeeeeeeee.........eeeeeeeeehhhhh........................hhhhhhhhhhhhhhh......eeeeeee.......hhhhhhhhhhh...eee..hhhhhhhhhhh..eeeeeeeeeee.....----..hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------PNP_MTAP_2  PDB: A:79-120 UniProt: 79-120 -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:3-33          --------------------------------------------------------Exon 1.4  PDB: A:90-124            Exon 1.5  PDB: A:125-183 UniProt: 125-183                  ---------------------------------------------------------------Exon 1.7  PDB: A:247-284 (gaps)        Transcript 1 (1)
           Transcript 1 (2) ------------------------------Exon 1.3  PDB: A:33-90 (gaps) UniProt: 33-90              --------------------------------------------------------------------------------------------Exon 1.6  PDB: A:183-247 UniProt: 183-247                        ------------------------------------- Transcript 1 (2)
                 2ai3 A   3 NGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPES------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDY----KANHEEVLEAGKQAAQKLEQFVSLLMASIPV 284
                                    12        22        32        42        52      |  -   |    72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242      |  - |     262       272       282  
                                                                                   59     66                                                                                                                                                                                    249  254                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2AI3)

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)
Chain A   (PNPH_BOVIN | P55859)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0004731    purine-nucleoside phosphorylase activity    Catalysis of the reaction: purine nucleoside + phosphate = purine + alpha-D-ribose 1-phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016757    transferase activity, transferring glycosyl groups    Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
    GO:0016763    transferase activity, transferring pentosyl groups    Catalysis of the transfer of a pentosyl group from one compound (donor) to another (acceptor).
biological process
    GO:0006139    nucleobase-containing compound metabolic process    Any cellular metabolic process involving nucleobases, nucleosides, nucleotides and nucleic acids.
    GO:0009116    nucleoside metabolic process    The chemical reactions and pathways involving a nucleoside, a nucleobase linked to either beta-D-ribofuranose (a ribonucleoside) or 2-deoxy-beta-D-ribofuranose, (a deoxyribonucleoside), e.g. adenosine, guanosine, inosine, cytidine, uridine and deoxyadenosine, deoxyguanosine, deoxycytidine and thymidine (= deoxythymidine).
    GO:0043101    purine-containing compound salvage    Any process that generates a purine-containing compound, any nucleobase, nucleoside, nucleotide or nucleic acid that contains a purine base, from derivatives of them without de novo synthesis.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    144  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    P2G  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:197 - Pro A:198   [ RasMol ]  
    Ile A:282 - Pro A:283   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ai3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PNPH_BOVIN | P55859
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.4.2.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PNPH_BOVIN | P55859
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PNPH_BOVIN | P558591a9o 1a9p 1a9q 1a9r 1a9s 1a9t 1b8n 1b8o 1fxu 1lv8 1lvu 1pbn 1v48 1vfn 2ai1 2ai2 2qpl 3fuc 3pnp 4pnp

(-) Related Entries Specified in the PDB File

2ai1 2ai2