|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2AFP) |
Sites (0, 0)| (no "Site" information available for 2AFP) |
SS Bonds (5, 5)
NMR Structure
|
||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2AFP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2AFP) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2AFP) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:129 aligned with ISP2_HEMAM | P05140 from UniProtKB/Swiss-Prot Length:163 Alignment length:129 44 54 64 74 84 94 104 114 124 134 144 154 ISP2_HEMAM 35 QRAPPNCPAGWQPLGDRCIYYETTAMTWALAETNCMKLGGHLASIHSQEEHSFIQTLNAGVVWIGGSACLQAGAWTWSDGTPMNFRSWCSTKPDDVLAACCMQMTAAADQCWDDLPCPASHKSVCAMTF 163 SCOP domains d2afpa_ A: Type II antifreeze protein SCOP domains CATH domains 2afpA00 A:1-129 Mannose-Binding Protein A, subunit A CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -------------C_TYPE_LECTIN_2 PDB: A:14-126 UniProt: 48-160 --- PROSITE (1) PROSITE (2) ----------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1 ---- PROSITE (2) Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript 2afp A 1 QRAGPNCPAGWQPLGDRCIYYETTAMTWALAETNCMKLGGHLASIHSQEEHSFIQTLNAGVVWIGGSACLQAGAWTWSDGTPMNFRSWCSTKPDDVLAACCMQMTAAADQCWDDLPCPASHKSVCAMTF 129 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2AFP) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (ISP2_HEMAM | P05140)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|