|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2AFE) |
Sites (0, 0)| (no "Site" information available for 2AFE) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2AFE) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2AFE) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2AFE) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2AFE) |
Exons (0, 0)| (no "Exon" information available for 2AFE) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:88 aligned with Q8YWG3_NOSS1 | Q8YWG3 from UniProtKB/TrEMBL Length:85 Alignment length:88 1 | 7 17 27 37 47 57 67 77 Q8YWG3_NOSS1 - ---MKTIQPCSVEDIQSWLIDQFAQQLDVDPDDIDMEESFDNYDLNSSKALILLGRLEKWLGKELNPVLIFNYPTIAQLAKRLGELYL 85 SCOP domains ---------------------------------------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------- Transcript 2afe A 1 GSHMKTIQPASVEDIQSWLIDQFAQQLDVDPDDIDMEESFDNYDLNSSKALILLGRLEKWLGKELNPVLIFNYPTIAQLAKRLGELYL 88 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2AFE) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2AFE) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2AFE) |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (Q8YWG3_NOSS1 | Q8YWG3)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|