2ACY - JenaLib

Asym./Biol. Unit - manually

Asym./Biol. Unit

Asym./Biol. Unit - sites

collapse

expand

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Description

Title :   ACYL-PHOSPHATASE (COMMON TYPE) FROM BOVINE TESTIS

Authors :   M. M. G. M. Thunnissen, P. Nordlund

Date :   08 Nov 96 (Deposition) - 12 Nov 97 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym./Biol. Unit : A

Keywords :   Acylphosphatase, Phosphoric Monoester Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. M. Thunnissen, N. Taddei, G. Liguri, G. Ramponi, P. Nordlund
Crystal Structure Of Common Type Acylphosphatase From Bovine Testis.
Structure V. 5 69 1997
PubMed-ID: 9016712 | Reference-DOI: 10.1016/S0969-2126(97)00167-6
(for further references see the PDB file header)

Compounds

Molecule 1 - ACYLPHOSPHATASE
	Cellular Location	:	CYTOPLASM
	Chains	:	A
	EC Number	:	3.6.1.7
	Organ	:	TESTIS
	Organism Common	:	CATTLE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913
	Synonym	:	ACP

Structural Features

Chains, Units

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (2, 3)

Asymmetric/Biological Unit (2, 3)

No.	Name	Count	Type	Full Name
1	CL	1	Ligand/Ion	CHLORIDE ION
2	SO4	2	Ligand/Ion	SULFATE ION

Sites (3, 3)

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	PHE A:21 , ARG A:23 , LYS A:24 , LYS A:68 , CL A:102 , HOH A:135 , HOH A:165 , HOH A:177	BINDING SITE FOR RESIDUE SO4 A 100
2	AC2	SOFTWARE	GLU A:29 , LYS A:32 , HIS A:60 , TRP A:64 , LYS A:68 , HOH A:135 , HOH A:165	BINDING SITE FOR RESIDUE SO4 A 101
3	AC3	SOFTWARE	VAL A:17 , GLN A:18 , GLY A:19 , VAL A:20 , PHE A:21 , PHE A:22 , SO4 A:100 , HOH A:107	BINDING SITE FOR RESIDUE CL A 102

SS Bonds (0, 0)

(no "SS Bond" information available for 2ACY)

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 2ACY)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 2ACY)

PROSITE Motifs (3, 3)

Asymmetric/Biological Unit (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ACYLPHOSPHATASE_3	PS51160	Acylphosphatase-like domain profile.	ACYP1_BOVIN	11-101	1	A:8-98
2	ACYLPHOSPHATASE_1	PS00150	Acylphosphatase signature 1.	ACYP1_BOVIN	16-26	1	A:13-23
3	ACYLPHOSPHATASE_2	PS00151	Acylphosphatase signature 2.	ACYP1_BOVIN	40-56	1	A:37-53

Exons (2, 2)

Asymmetric/Biological Unit (2, 2)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000018595	1	ENSBTAE00000318229	chr10:88782227-88782144	84	ACYP1_BOVIN	-	0	0	-	-
1.2	ENSBTAT00000018595	2	ENSBTAE00000151453	chr10:88781732-88781635	98	ACYP1_BOVIN	1-30	30	1	A:1-27	27
1.3	ENSBTAT00000018595	3	ENSBTAE00000151454	chr10:88776364-88775946	419	ACYP1_BOVIN	31-101	71	1	A:28-98	71

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:98
 aligned with ACYP1_BOVIN | P41500 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:98
                                    13        23        33        43        53        63        73        83        93        
          ACYP1_BOVIN     4 AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK 101
               SCOP domains d2acya_ A: Acylphosphatase                                                                         SCOP domains
               CATH domains 2acyA00 A:1-98  [code=3.30.70.100, no name defined]                                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeeeee.....hhhhhhhhhhh...eeeeee.....eeeeeeeehhhhhhhhhhhhh......eeeeeeeeeeee........eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------ACYLPHOSPHATASE_3  PDB: A:8-98 UniProt: 11-101                                              PROSITE (1)
                PROSITE (2) ------------ACYLPHOSPHA-------------ACYLPHOSPHATASE_2--------------------------------------------- PROSITE (2)
               Transcript 1 Exon 1.2  PDB: A:1-27      Exon 1.3  PDB: A:28-98 UniProt: 31-101                                  Transcript 1
                 2acy A   1 AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK  98
                                    10        20        30        40        50        60        70        80        90

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Ferredoxin-like (1795)

Superfamily: Acylphosphatase/BLUF domain-like (38)

Family: Acylphosphatase-like (16)

Protein domain: Acylphosphatase (5)

Cow (Bos taurus) [TaxId: 9913] (1)

d2acya_

CATH Domains (1, 1)

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Alpha-Beta Plaits (1688)

Homologous Superfamily: [code=3.30.70.100, no name defined] (82)

Cattle (Bos taurus) (1)

2acyA00

A:1-98

Pfam Domains (0, 0)

(no "Pfam Domain" information available for 2ACY)

Gene Ontology (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (ACYP1_BOVIN | P41500)

molecular function
	GO:0003998		acylphosphatase activity		Catalysis of the reaction: an acyl phosphate + H2O = a carboxylate + phosphate.
	GO:0016787		hydrolase activity		Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2acy)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2acy
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ACYP1_BOVIN \| P41500
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.6.1.7
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ACYP1_BOVIN \| P41500
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 3)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 3)

Exons (2, 2)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (2, 2)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File