Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF DESULFOVIBRIO DESULFURICANS G20 TETRAHEME CYTOCHROME (OXIDIZED FORM)
 
Authors :  M. V. Pattarkine, J. J. Tanner, C. A. Bottoms, Y. H. Lee, J. D. Wall
Date :  25 Jun 05  (Deposition) - 25 Apr 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A
Keywords :  Desulfovibrio, Tetraheme Cytochrome, Cytochrome C3, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. V. Pattarkine, J. J. Tanner, C. A. Bottoms, Y. H. Lee, J. D. Wall
Desulfovibrio Desulfuricans G20 Tetraheme Cytochrome Structure At 1. 5A And Cytochrome Interaction With Metal Complexes
J. Mol. Biol. V. 358 1314 2006
PubMed-ID: 16580681  |  Reference-DOI: 10.1016/J.JMB.2006.03.010

(-) Compounds

Molecule 1
    Chains: A
    Engineered: YES
    Expression System: DESULFOVIBRIO DESULFURICANS SUBSP. DESULFURICANS STR. G20
    Expression System Strain: SUBSP. DESULFURICANS STR. G20
    Expression System Taxid: 207559
    Organism Scientific: DESULFOVIBRIO DESULFURICANS SUBSP. DESULFURICANS STR.
    Organism Taxid: 207559
    Strain: G20

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
1HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:1 , GLU A:2 , ALA A:3 , PRO A:4 , LEU A:8 , MET A:10 , PHE A:19 , HIS A:21 , HIS A:24 , GLN A:28 , CYS A:29 , CYS A:32 , HIS A:33 , LEU A:42 , LYS A:44 , CYS A:45 , HEM A:503 , HOH A:513 , HOH A:571 , HOH A:577BINDING SITE FOR RESIDUE HEM A 501
2AC2SOFTWARECYS A:32 , HIS A:33 , HIS A:34 , ASN A:41 , ALA A:43 , LYS A:44 , CYS A:45 , CYS A:50 , HIS A:51 , VAL A:61 , LYS A:66 , ILE A:67 , VAL A:76 , ALA A:77 , HOH A:523BINDING SITE FOR RESIDUE HEM A 502
3AC3SOFTWAREASN A:20 , SER A:23 , HIS A:24 , TYR A:27 , CYS A:79 , CYS A:82 , HIS A:83 , LYS A:101 , LYS A:104 , HEM A:501 , HEM A:504 , HOH A:517 , HOH A:543 , HOH A:553BINDING SITE FOR RESIDUE HEM A 503
4AC4SOFTWAREMET A:10 , GLU A:11 , ASN A:12 , THR A:13 , MET A:15 , PRO A:16 , VAL A:17 , PHE A:54 , TYR A:64 , TYR A:65 , ILE A:68 , HIS A:69 , CYS A:79 , MET A:80 , HIS A:83 , LEU A:97 , THR A:98 , GLY A:99 , CYS A:100 , CYS A:105 , HIS A:106 , HEM A:503 , HOH A:549BINDING SITE FOR RESIDUE HEM A 504

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2A3M)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2A3M)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2A3M)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2A3M)

(-) Exons   (0, 0)

(no "Exon" information available for 2A3M)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:107
 aligned with Q30WH0_DESAG | Q30WH0 from UniProtKB/TrEMBL  Length:130

    Alignment length:107
                                    33        43        53        63        73        83        93       103       113       123       
         Q30WH0_DESAG    24 AEAPADGLKMENTKMPVIFNHSSHSSYQCADCHHPVDGKENLAKCATAGCHDVFDKKDKSVHSYYKIIHDRKATTVATCMSCHLEAAGSDKDLKKELTGCKKSKCHP 130
               SCOP domains d2a3ma_ A: automated matches                                                                                SCOP domains
               CATH domains 2a3mA00 A:1-107 Cytochrome C3                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eee......eeehhhhhh..hhhhh..............................hhhhhhhh.......hhhhhhhhhhh.hhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 2a3m A   1 AEAPADGLKMENTKMPVIFNHSSHSSYQCADCHHPVDGKENLAKCATAGCHDVFDKKDKSVHSYYKIIHDRKATTVATCMSCHLEAAGSDKDLKKELTGCKKSKCHP 107
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2A3M)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q30WH0_DESAG | Q30WH0)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2a3m)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2a3m
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q30WH0_DESAG | Q30WH0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q30WH0_DESAG | Q30WH0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q30WH0_DESAG | Q30WH0: 2a3p

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2A3M)