|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2A1V) |
Sites (0, 0)| (no "Site" information available for 2A1V) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2A1V) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2A1V) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2A1V) |
Exons (0, 0)| (no "Exon" information available for 2A1V) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:138 aligned with Q9RRT5_DEIRA | Q9RRT5 from UniProtKB/TrEMBL Length:132 Alignment length:138 132 10 20 30 40 50 60 70 80 90 100 110 120 130 | Q9RRT5_DEIRA 1 MQTPMQTVDDLRSVCDELPHSLETFPFDDETLVFKVGYLSKSRMYALTDITQDPLRLSLKVDPERGEELRQAHPQSIAPGYHLNKKHWVTVTLDGTVPAELLGELLRGSYLLVTKKGFTKAERKELGLPDSL------ - SCOP domains -d2a1va1 A:4-134 Hypothetical protein DR2400 ------ SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript 2a1v A 3 LQTPMQTVDDLRSVCDELPHSLETFPFDDETLVFKVGYLSKSRMYALTDITQDPLRLSLKVDPERGEELRQAHPQSIAPGYHLNKKHWVTVTLDGTVPAELLGELLRGSYLLVTKKGFTKAERKELGLPDSLEGGSHH 140 12 22 32 42 52 62 72 82 92 102 112 122 132
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2A1V) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2A1V) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2A1V)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|