|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1ZU1) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1ZU1) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1ZU1) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1ZU1) |
Exons (0, 0)| (no "Exon" information available for 1ZU1) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:127 aligned with ZN346_XENLA | Q8AVN9 from UniProtKB/Swiss-Prot Length:524 Alignment length:127 11 21 31 41 51 61 71 81 91 101 111 121 ZN346_XENLA 2 ADEFGNGDALDLPVGKDAVNSLIRENSHIFSDTQCKVCSAVLISESQKLAHYQSRKHANKVRRYMAINQGEDSVPAKKFKAAPAEISDGEDRSKCCPVCNMTFSSPVVAESHYIGKTHIKNLRLREQ 128 SCOP domains d1zu1a1 A:2-73 dsRNA-binding protein ZFa (ZNF346, JAZ) d1zu1a2 A:74-128 SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) ---------------------------------------------------------------------------------------------zf-met-1zu1A01 A:95-119 --------- Pfam domains (1) Pfam domains (2) ---------------------------------------------------------------------------------------------zf-met-1zu1A02 A:95-119 --------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript 1zu1 A 2 ADEFGNGDALDLPVGKDAVNSLIRENSHIFSDTQCKVCSAVLISESQKLAHYQSRKHANKVRRYMAINQGEDSVPAKKFKAAPAEISDGEDRSKCCPVCNMTFSSPVVAESHYIGKTHIKNLRLREQ 128 11 21 31 41 51 61 71 81 91 101 111 121
|
||||||||||||||||||||
SCOP Domains (1, 2)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1ZU1) |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (8, 8)|
NMR Structure(hide GO term definitions) Chain A (ZN346_XENLA | Q8AVN9)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|