Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  HYPOTHETICAL PROTEIN PFU-631545-001 FROM PYROCOCCUS FURIOSUS
 
Authors :  Z. -Q. Fu, P. Horanyi, Q. Florence, Z. -J. Liu, L. Chen, D. Lee, J. Habel, H. Xu, D. Nguyen, S. -H. Chang, W. Zhou, H. Zhang, F. E. Jenney Jr. , B. Sha, M. W. W. Adams, J. P. Rose, B. -C. Wang, Southeast Collaboratory For Structural Genomics (Secsg)
Date :  26 May 05  (Deposition) - 07 Jun 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Southeast Collaboratory For Structural Genomics, Secsg, Protein Structure Initiative, Psi, Conserved Hypothetical Protein, Pyrococcus Furiosus, Hyperthermophile, Pfu-631545-001, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Z. -Q. Fu, P. Horanyi, Q. Florence, Z. -J. Liu, L. Chen, D. Lee, J. Habel, H. Xu, D. Nguyen, S. -H. Chang, W. Zhou, H. Zhang, F. E. Jenney Jr. , B. Sha, M. W. W. Adams, J. P. Rose, B. -C. Wang
Hypothetical Protein Pfu-631545-001 From Pyrococcus Furiosus
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN PFU-631545-001
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET24D BAM
    Expression System Strain: C41 PRIL
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: PYROCOCCUS FURIOSUS
    Organism Taxid: 2261

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1ZTD)

(-) Sites  (0, 0)

(no "Site" information available for 1ZTD)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1ZTD)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1ZTD)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1ZTD)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1ZTD)

(-) Exons   (0, 0)

(no "Exon" information available for 1ZTD)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:125
 aligned with Q8U363_PYRFU | Q8U363 from UniProtKB/TrEMBL  Length:125

    Alignment length:125
                                    10        20        30        40        50        60        70        80        90       100       110       120     
         Q8U363_PYRFU     1 MEIDKGLAKFGDSLINFLYSLALTEFLGKPTGDRVPNASLAIALDLTGLSKNLRRVDKHAKGDYAEALIAKAWLMGLISEREAVEIIKKNLTPEVLDFSKKKEAIGRALAPLLVIISERLTSSQV 125
               SCOP domains -d1ztda1 A:2-125 Hypothetical protein PF0609                                                                                  SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ztd A   1 SEIDKGLAKFGDSLINFLYSLALTEFLGKPTGDRVPNASLAIALELTGLSKNLRRVDKHAKGDYAEALIAKAWLMGLISEREAVEIIKKNLYPEVLDFSKKKEAIGRALAPLLVIISERLYSSQV 125
                                    10        20        30        40        50        60        70        80        90       100       110       120     


Chain B from PDB  Type:PROTEIN  Length:125
 aligned with Q8U363_PYRFU | Q8U363 from UniProtKB/TrEMBL  Length:125

    Alignment length:125
                                    10        20        30        40        50        60        70        80        90       100       110       120     
         Q8U363_PYRFU     1 MEIDKGLAKFGDSLINFLYSLALTEFLGKPTGDRVPNASLAIALDLTGLSKNLRRVDKHAKGDYAEALIAKAWLMGLISEREAVEIIKKNLTPEVLDFSKKKEAIGRALAPLLVIISERLTSSQV 125
               SCOP domains d1ztdb_ B: automated matches                                                                                                  SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----DUF3204-1ztdB01 B:5-123                                                                                                -- Pfam domains (1)
           Pfam domains (2) ----DUF3204-1ztdB02 B:5-123                                                                                                -- Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ztd B   1 SEIDKGLAKFGDSLINFLYSLALTEFLGKPTGDRVPNASLAIALELTGLSKNLRRVDKHAKGDYAEALIAKAWLMGLISEREAVEIIKKNLYPEVLDFSKKKEAIGRALAPLLVIISERLYSSQV 125
                                    10        20        30        40        50        60        70        80        90       100       110       120
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1ZTD)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: DUF3204] (1)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q8U363_PYRFU | Q8U363)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0004525    ribonuclease III activity    Catalysis of the endonucleolytic cleavage of RNA with 5'-phosphomonoesters and 3'-OH termini; makes two staggered cuts in both strands of dsRNA, leaving a 3' overhang of 2 nt.
biological process
    GO:0090501    RNA phosphodiester bond hydrolysis    The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0006396    RNA processing    Any process involved in the conversion of one or more primary RNA transcripts into one or more mature RNA molecules.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ztd)
 
  Sites
(no "Sites" information available for 1ztd)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ztd)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ztd
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8U363_PYRFU | Q8U363
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8U363_PYRFU | Q8U363
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1ZTD)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1ZTD)