Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A STEREOSELECTIVE ESTERASE FROM PSEUDOMONAS PUTIDA IFO12996
 
Authors :  F. Elmi, H. T. Lee, J. Y. Huang, Y. C. Hsieh, Y. L. Wang, Y. J. Chen, S. Y. Shaw, C. J. Chen
Date :  13 May 05  (Deposition) - 02 May 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Esterase, Pseudomonas Putida, Alpha/Beta Hydrolase Fold (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. Elmi, H. T. Lee, J. Y. Huang, Y. C. Hsieh, Y. L. Wang, Y. J. Chen, S. Y. Shaw, C. J. Chen
Stereoselective Esterase From Pseudomonas Putida Ifo12996 Reveals Alpha/Beta Hydrolase Folds For D-Beta-Acetylthioisobutyric Acid Synthesis
J. Bacteriol. V. 187 8470 2005
PubMed-ID: 16321951  |  Reference-DOI: 10.1128/JB.187.24.8470-8476.2005
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ESTERASE
    ChainsA, B, C
    EC Number3.1.-.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificPSEUDOMONAS PUTIDA
    Organism Taxid303

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1ZOI)

(-) Sites  (0, 0)

(no "Site" information available for 1ZOI)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1ZOI)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Trp A:31 -Pro A:32
2Pro A:125 -Pro A:126
3Trp B:31 -Pro B:32
4Pro B:125 -Pro B:126
5Trp C:31 -Pro C:32
6Pro C:125 -Pro C:126

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1ZOI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1ZOI)

(-) Exons   (0, 0)

(no "Exon" information available for 1ZOI)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:275
 aligned with Q3HWU8_PSEPU | Q3HWU8 from UniProtKB/TrEMBL  Length:276

    Alignment length:275
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271     
         Q3HWU8_PSEPU     2 SYVTTKDGVQIFYKDWGPRDAPVIHFHHGWPLSADDWDAQLLFFLAHGYRVVAHDRRGHGRSSQVWDGHDMDHYADDVAAVVAHLGIQGAVHVGHSTGGGEVVRYMARHPEDKVAKAVLIAAVPPLMVQTPGNPGGLPKSVFDGFQAQVASNRAQFYRDVPAGPFYGYNRPGVEASEGIIGNWWRQGMIGSAKAHYDGIVAFSQTDFTEDLKGIQQPVLVMHGDDDQIVPYENSGVLSAKLLPNGALKTYKGYPHGMPTTHADVINADLLAFIRS 276
               SCOP domains d1zoia_ A: automated matches                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1zoiA00 A:2-276  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.....eeeeeee......eeeee.....hhhhhhhhhhhhhhh..eeeee...............hhhhhhhhhhhhhhhhh....eeeee.hhhhhhhhhhhhh.......eeee.................hhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...eeeeee..........hhhhhhhhh..eeeeee.....hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zoi A   2 SYVTTKDGVQIFYKDWGPRDAPVIHFHHGWPLSADDWDAQLLFFLAHGYRVVAHDRRGHGRSSQVWDGHDMDHYADDVAAVVAHLGIQGAVHVGHSTGGGEVVRYMARHPEDKVAKAVLIAAVPPLMVQTPGNPGGLPKSVFDGFQAQVASNRAQFYRDVPAGPFYGYNRPGVEASEGIIGNWWRQGMIGSAKAHYDGIVAFSQTDFTEDLKGIQQPVLVMHGDDDQIVPYENSGVLSAKLLPNGALKTYKGYPHGMPTTHADVINADLLAFIRS 276
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271     

Chain B from PDB  Type:PROTEIN  Length:274
 aligned with Q3HWU8_PSEPU | Q3HWU8 from UniProtKB/TrEMBL  Length:276

    Alignment length:274
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271    
         Q3HWU8_PSEPU     2 SYVTTKDGVQIFYKDWGPRDAPVIHFHHGWPLSADDWDAQLLFFLAHGYRVVAHDRRGHGRSSQVWDGHDMDHYADDVAAVVAHLGIQGAVHVGHSTGGGEVVRYMARHPEDKVAKAVLIAAVPPLMVQTPGNPGGLPKSVFDGFQAQVASNRAQFYRDVPAGPFYGYNRPGVEASEGIIGNWWRQGMIGSAKAHYDGIVAFSQTDFTEDLKGIQQPVLVMHGDDDQIVPYENSGVLSAKLLPNGALKTYKGYPHGMPTTHADVINADLLAFIR 275
               SCOP domains d1zoib_ B: automated matches                                                                                                                                                                                                                                                       SCOP domains
               CATH domains 1zoiB00 B:2-275  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                                              CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.....eeeeeee......eeeee.....hhhhhhhhhhhhhh...eeeee...............hhhhhhhhhhhhhhhhh....eeeee.hhhhhhhhhhhhh.......eeee.................hhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...eeeeee..........hhhhhhhhh..eeeeee.....hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zoi B   2 SYVTTKDGVQIFYKDWGPRDAPVIHFHHGWPLSADDWDAQLLFFLAHGYRVVAHDRRGHGRSSQVWDGHDMDHYADDVAAVVAHLGIQGAVHVGHSTGGGEVVRYMARHPEDKVAKAVLIAAVPPLMVQTPGNPGGLPKSVFDGFQAQVASNRAQFYRDVPAGPFYGYNRPGVEASEGIIGNWWRQGMIGSAKAHYDGIVAFSQTDFTEDLKGIQQPVLVMHGDDDQIVPYENSGVLSAKLLPNGALKTYKGYPHGMPTTHADVINADLLAFIR 275
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271    

Chain C from PDB  Type:PROTEIN  Length:275
 aligned with Q3HWU8_PSEPU | Q3HWU8 from UniProtKB/TrEMBL  Length:276

    Alignment length:275
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271     
         Q3HWU8_PSEPU     2 SYVTTKDGVQIFYKDWGPRDAPVIHFHHGWPLSADDWDAQLLFFLAHGYRVVAHDRRGHGRSSQVWDGHDMDHYADDVAAVVAHLGIQGAVHVGHSTGGGEVVRYMARHPEDKVAKAVLIAAVPPLMVQTPGNPGGLPKSVFDGFQAQVASNRAQFYRDVPAGPFYGYNRPGVEASEGIIGNWWRQGMIGSAKAHYDGIVAFSQTDFTEDLKGIQQPVLVMHGDDDQIVPYENSGVLSAKLLPNGALKTYKGYPHGMPTTHADVINADLLAFIRS 276
               SCOP domains d1zoic_ C: automated matches                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1zoiC00 C:2-276  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                                               CATH domains
           Pfam domains (1) -----------------------Abhydrolase_6-1zoiC01 C:25-269                                                                                                                                                                                                                       ------- Pfam domains (1)
           Pfam domains (2) -----------------------Abhydrolase_6-1zoiC02 C:25-269                                                                                                                                                                                                                       ------- Pfam domains (2)
           Pfam domains (3) -----------------------Abhydrolase_6-1zoiC03 C:25-269                                                                                                                                                                                                                       ------- Pfam domains (3)
         Sec.struct. author .eee.....eeeeeee......eeeee.....hhhhhhhhhhhhhh...eeeee...............hhhhhhhhhhhhhhhhh....eeeee.hhhhhhhhhhhhh.......eeee.................hhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhh.hhhhhhhhhhhhhh..hhhhhhhh...eeeeee..........hhhhhhhhh..eeeeee.....hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zoi C   2 SYVTTKDGVQIFYKDWGPRDAPVIHFHHGWPLSADDWDAQLLFFLAHGYRVVAHDRRGHGRSSQVWDGHDMDHYADDVAAVVAHLGIQGAVHVGHSTGGGEVVRYMARHPEDKVAKAVLIAAVPPLMVQTPGNPGGLPKSVFDGFQAQVASNRAQFYRDVPAGPFYGYNRPGVEASEGIIGNWWRQGMIGSAKAHYDGIVAFSQTDFTEDLKGIQQPVLVMHGDDDQIVPYENSGVLSAKLLPNGALKTYKGYPHGMPTTHADVINADLLAFIRS 276
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 3)

Asymmetric/Biological Unit

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1ZOI)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1zoi)
 
  Sites
(no "Sites" information available for 1zoi)
 
  Cis Peptide Bonds
    Pro A:125 - Pro A:126   [ RasMol ]  
    Pro B:125 - Pro B:126   [ RasMol ]  
    Pro C:125 - Pro C:126   [ RasMol ]  
    Trp A:31 - Pro A:32   [ RasMol ]  
    Trp B:31 - Pro B:32   [ RasMol ]  
    Trp C:31 - Pro C:32   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1zoi
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q3HWU8_PSEPU | Q3HWU8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.1.-.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q3HWU8_PSEPU | Q3HWU8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1ZOI)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1ZOI)