Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF NUCLEAR TRANSPORT FACTOR 2 (NTF2) FROM CRYPTOSPORIDIUM PARVUM
 
Authors :  J. Choe, J. D. Artz, M. Gao, J. Lew, Y. Zhao, C. Arrowsmith, A. Edwards, M. Sundstrom, A. Bochkarev, R. Hui, Structural Genomics Consortium (Sgc)
Date :  12 May 05  (Deposition) - 31 May 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Nuclear Transport, Structural Genomics, Structural Genomics Consortium, Sgc, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Vedadi, J. Lew, J. Artz, M. Amani, Y. Zhao, A. Dong, G. A. Wasney, M. Gao, T. Hills, S. Brokx, W. Qiu, S. Sharma, A. Diassiti, Z. Alam, M. Melone, A. Mulichak, A. Wernimont, J. Bray, P. Loppnau, O. Plotnikova, K. Newberry, E. Sundararajan, S. Houston, J. Walker, W. Tempel, A. Bochkarev, I. Kozieradzki, A. Edwards, C. Arrowsmith, D. Roos, K. Kain, R. Hui
Genome-Scale Protein Expression And Structural Biology Of Plasmodium Falciparum And Related Apicomplexan Organisms.
Mol. Biochem. Parasitol. V. 151 100 2007
PubMed-ID: 17125854  |  Reference-DOI: 10.1016/J.MOLBIOPARA.2006.10.011
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NUCLEAR TRANSPORT FACTOR 2
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET28
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism ScientificCRYPTOSPORIDIUM PARVUM
    Organism Taxid5807
    SynonymNTF2

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1ZO2)

(-) Sites  (0, 0)

(no "Site" information available for 1ZO2)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1ZO2)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1ZO2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1ZO2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1ZO2)

(-) Exons   (0, 0)

(no "Exon" information available for 1ZO2)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:124
 aligned with Q5CQI4_CRYPI | Q5CQI4 from UniProtKB/TrEMBL  Length:129

    Alignment length:124
                                    13        23        33        43        53        63        73        83        93       103       113       123    
         Q5CQI4_CRYPI     4 SINLNPQFDQIGKQFVQHYYQTFQTNRPALGGLYGPQSMLTWEDTQFQGQANIVNKFNSLNFQRVQFEITRVDCQPSPNNGSIVFVTGDVRIDDGQPLKFSQVFNLMPSGNGGFMIFNDLFRLN 127
               SCOP domains -------d1zo2a1 A:10-126 Nuclear transport factor-2 (NTF2)                                                                    SCOP domains
               CATH domains 1zo2A00 A:3-126  [code=3.10.450.50, no name defined]                                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeeee..eeeehhhhhhhhhhhhh...eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zo2 A   3 SINLNPQFDQIGKQFVQHYYQTFQTNRPALGGLYGPQSMLTWEDTQFQGQANIVNKFNSLNFQRVQFEITRVDCQPSPNNGSIVFVTGDVRIDDGQPLKFSQVFNLMPSGNGGFMIFNDLFRLN 126
                                    12        22        32        42        52        62        72        82        92       102       112       122    

Chain B from PDB  Type:PROTEIN  Length:124
 aligned with Q5CQI4_CRYPI | Q5CQI4 from UniProtKB/TrEMBL  Length:129

    Alignment length:124
                                    13        23        33        43        53        63        73        83        93       103       113       123    
         Q5CQI4_CRYPI     4 SINLNPQFDQIGKQFVQHYYQTFQTNRPALGGLYGPQSMLTWEDTQFQGQANIVNKFNSLNFQRVQFEITRVDCQPSPNNGSIVFVTGDVRIDDGQPLKFSQVFNLMPSGNGGFMIFNDLFRLN 127
               SCOP domains d1zo2b_ B: automated matches                                                                                                 SCOP domains
               CATH domains 1zo2B00 B:3-126  [code=3.10.450.50, no name defined]                                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeeee..eeeehhhhhhhhhhhh....eeeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeee.....eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zo2 B   3 SINLNPQFDQIGKQFVQHYYQTFQTNRPALGGLYGPQSMLTWEDTQFQGQANIVNKFNSLNFQRVQFEITRVDCQPSPNNGSIVFVTGDVRIDDGQPLKFSQVFNLMPSGNGGFMIFNDLFRLN 126
                                    12        22        32        42        52        62        72        82        92       102       112       122    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1ZO2)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q5CQI4_CRYPI | Q5CQI4)
biological process
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1zo2)
 
  Sites
(no "Sites" information available for 1zo2)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1zo2)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1zo2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5CQI4_CRYPI | Q5CQI4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q5CQI4_CRYPI | Q5CQI4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1ZO2)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1ZO2)