1ZN7 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   HUMAN ADENINE PHOSPHORIBOSYLTRANSFERASE COMPLEXED WITH PRPP, ADE AND R5P

Authors :   J. Iulek, M. Silva, C. H. T. P. Tomich, O. H. Thiemann

Date :   11 May 05 (Deposition) - 25 Apr 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.83

Chains :   Asym./Biol. Unit : A,B

Keywords :   Transferase, Glycosyltransferase, Purine Salvage (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. H. Silva, M. Silva, J. Iulek, O. H. Thiemann
Structural Complexes Of Human Adenine Phosphoribosyltransferase Reveal Novel Features Of The Aprt Catalytic Mechanism
J. Biomol. Struct. Dyn. V. 25 589 2008
PubMed-ID: 18399692

Molecule 1 - ADENINE PHOSPHORIBOSYLTRANSFERASE
	Chains	:	A, B
	EC Number	:	2.4.2.7
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET29A
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	APRT
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	APRT

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (5, 10)

No.	Name	Count	Type	Full Name
1	ADE	2	Ligand/Ion	ADENINE
2	HSX	2	Ligand/Ion	5-O-PHOSPHONO-ALPHA-D-RIBOFURANOSE
3	MG	2	Ligand/Ion	MAGNESIUM ION
4	PO4	2	Ligand/Ion	PHOSPHATE ION
5	PRP	2	Ligand/Ion	ALPHA-PHOSPHORIBOSYLPYROPHOSPHORIC ACID

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	PRP A:502 , PO4 A:504 , HSX A:506 , HOH A:662 , HOH A:663	BINDING SITE FOR RESIDUE MG A 500
02	AC2	SOFTWARE	SER A:66 , ARG A:67 , LYS A:88 , MG A:500 , HSX A:506 , HOH A:663 , ARG B:87 , LYS B:91	BINDING SITE FOR RESIDUE PO4 A 504
03	AC3	SOFTWARE	ARG A:87 , LYS A:91 , SER B:66 , ARG B:67 , LYS B:88 , MG B:501 , HSX B:507 , HOH B:663 , HOH B:664	BINDING SITE FOR RESIDUE PO4 A 505
04	AC4	SOFTWARE	SER A:66 , ARG A:67 , LYS A:88 , ASP A:127 , ASP A:128 , LEU A:129 , ALA A:131 , THR A:132 , GLY A:133 , GLY A:134 , THR A:135 , MG A:500 , ADE A:655 , HOH A:658 , HOH A:662 , HOH A:663 , HOH A:687 , HOH A:729 , HOH A:745 , HOH A:819 , HOH A:829 , ARG B:87 , LYS B:91	BINDING SITE FOR RESIDUE PRP A 502
05	AC5	SOFTWARE	ARG A:67 , ASP A:127 , ASP A:128 , LEU A:129 , ALA A:131 , THR A:132 , GLY A:133 , GLY A:134 , THR A:135 , MG A:500 , PO4 A:504 , HOH A:658 , HOH A:659 , HOH A:687 , HOH A:745 , HOH A:819 , HOH A:829	BINDING SITE FOR RESIDUE HSX A 506
06	AC6	SOFTWARE	VAL A:25 , PHE A:26 , ARG A:27 , ARG A:67 , LEU A:129 , ALA A:131 , LEU A:159 , PRP A:502 , HOH A:656 , HOH A:657 , HOH A:658 , HOH A:659 , HOH A:660 , HOH A:661 , HOH A:809	BINDING SITE FOR RESIDUE ADE A 655
07	AC7	SOFTWARE	PO4 A:505 , PRP B:503 , HSX B:507 , HOH B:663 , HOH B:664	BINDING SITE FOR RESIDUE MG B 501
08	AC8	SOFTWARE	ARG A:87 , LYS A:91 , SER B:66 , ARG B:67 , LYS B:88 , ASP B:127 , ASP B:128 , LEU B:129 , ALA B:131 , THR B:132 , GLY B:133 , GLY B:134 , THR B:135 , MG B:501 , ADE B:656 , HOH B:657 , HOH B:663 , HOH B:664 , HOH B:701 , HOH B:717 , HOH B:794 , HOH B:796 , HOH B:836 , HOH B:846	BINDING SITE FOR RESIDUE PRP B 503
09	AC9	SOFTWARE	PO4 A:505 , ARG B:67 , ASP B:127 , ASP B:128 , LEU B:129 , ALA B:131 , THR B:132 , GLY B:133 , GLY B:134 , THR B:135 , MG B:501 , HOH B:657 , HOH B:701 , HOH B:717 , HOH B:796 , HOH B:836	BINDING SITE FOR RESIDUE HSX B 507
10	BC1	SOFTWARE	VAL B:25 , PHE B:26 , ARG B:27 , ARG B:67 , LEU B:129 , ALA B:131 , LEU B:159 , PRP B:503 , HOH B:657 , HOH B:659 , HOH B:660 , HOH B:661 , HOH B:662 , HOH B:819 , HOH B:838	BINDING SITE FOR RESIDUE ADE B 656

(no "SS Bond" information available for 1ZN7)

Asymmetric/Biological Unit

No.	Residues
1	Phe A:19	-	Pro A:20
2	Asp A:65	-	Ser A:66
3	Ala A:169	-	Pro A:170
4	Phe B:19	-	Pro B:20
5	Asp B:65	-	Ser B:66
6	Ala B:169	-	Pro B:170

Asymmetric/Biological Unit (9, 18)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_069049	L	33	P	APT_HUMAN	Disease (APRTD)	---	A/B	L	33	P
2	UniProt	VAR_006747	D	65	V	APT_HUMAN	Disease (APRTD)	104894506	A/B	D	65	V
3	UniProt	VAR_069050	V	84	M	APT_HUMAN	Disease (APRTD)	200392753	A/B	V	84	M
4	UniProt	VAR_006748	L	110	P	APT_HUMAN	Disease (APRTD)	104894508	A/B	L	110	P
5	UniProt	VAR_019055	Q	121	R	APT_HUMAN	Polymorphism	8191494	A/B	Q	121	R
6	UniProt	VAR_069051	G	133	D	APT_HUMAN	Disease (APRTD)	---	A/B	G	133	D
7	UniProt	VAR_006749	M	136	T	APT_HUMAN	Disease (APRTD)	28999113	A/B	M	136	T
8	UniProt	VAR_022608	V	150	F	APT_HUMAN	Disease (APRTD)	281860266	A/B	V	150	F
9	UniProt	VAR_022609	C	153	R	APT_HUMAN	Disease (APRTD)	---	A/B	C	153	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PUR_PYR_PR_TRANSFER	PS00103	Purine/pyrimidine phosphoribosyl transferases signature.	APT_HUMAN	123-135	2	A:123-135 B:123-135

Asymmetric/Biological Unit (5, 10)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000378364	1	ENSE00001436135	chr16:88878342-88878228	115	APT_HUMAN	1-27	27	2	A:3-27 B:3-27	25 25
1.2	ENST00000378364	2	ENSE00001503918	chr16:88878064-88877958	107	APT_HUMAN	27-63	37	2	A:27-63 B:27-63	37 37
1.3	ENST00000378364	3	ENSE00001503917	chr16:88876964-88876831	134	APT_HUMAN	63-107	45	2	A:63-107 B:63-107	45 45
1.4	ENST00000378364	4	ENSE00001436356	chr16:88876556-88876478	79	APT_HUMAN	108-134	27	2	A:108-134 B:108-134	27 27
1.5a	ENST00000378364	5a	ENSE00001436502	chr16:88876248-88875877	372	APT_HUMAN	134-180	47	2	A:134-180 B:134-180	47 47

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:178
 aligned with APT_HUMAN | P07741 from UniProtKB/Swiss-Prot  Length:180

    Alignment length:178
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172        
            APT_HUMAN     3 DSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE 180
               SCOP domains d1zn7a_ A: Adenine PRTase                                                                                                                                                          SCOP domains
               CATH domains 1zn7A00 A:3-180  [code=3.40.50.2020, no name defined]                                                                                                                              CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhh..eeee.......eeeehhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee.hhhhhhhhhhhhhhh.eeeeeee.......eeeeeeee..eeeeeeee........eeeeeeeee..hhhhhhhhhhhhhh..eeeeeeeeeee...hhhhhhh...eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------P-------------------------------V------------------M-------------------------P----------R-----------D--T-------------F--R--------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------PUR_PYR_PR_TR--------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:3-27    -----------------------------------Exon 1.3  PDB: A:63-107 UniProt: 63-107      Exon 1.4  PDB: A:108-134   ---------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------Exon 1.2  PDB: A:27-63 UniProt: 27-63----------------------------------------------------------------------Exon 1.5a  PDB: A:134-180 UniProt: 134-180      Transcript 1 (2)
                 1zn7 A   3 DSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE 180
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172

Chain B from PDB  Type:PROTEIN  Length:178
 aligned with APT_HUMAN | P07741 from UniProtKB/Swiss-Prot  Length:180

    Alignment length:178
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172        
            APT_HUMAN     3 DSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE 180
               SCOP domains d1zn7b_ B: Adenine PRTase                                                                                                                                                          SCOP domains
               CATH domains 1zn7B00 B:3-180  [code=3.40.50.2020, no name defined]                                                                                                                              CATH domains
           Pfam domains (1) ---------------------------Pribosyltran-1zn7B01 B:30-157                                                                                                   ----------------------- Pfam domains (1)
           Pfam domains (2) ---------------------------Pribosyltran-1zn7B02 B:30-157                                                                                                   ----------------------- Pfam domains (2)
         Sec.struct. author .hhhhhhhh..eeee.......eeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee.hhhhhhhhhhhhhhh.eeeeeee.......eeeeeeee..eeeeeeee........eeeeeeeee..hhhhhhhhhhhhhh..eeeeeeeeeee...hhhhhhh...eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------P-------------------------------V------------------M-------------------------P----------R-----------D--T-------------F--R--------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------PUR_PYR_PR_TR--------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: B:3-27    -----------------------------------Exon 1.3  PDB: B:63-107 UniProt: 63-107      Exon 1.4  PDB: B:108-134   ---------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------Exon 1.2  PDB: B:27-63 UniProt: 27-63----------------------------------------------------------------------Exon 1.5a  PDB: B:134-180 UniProt: 134-180      Transcript 1 (2)
                 1zn7 B   3 DSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE 180
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: PRTase-like (145)

Superfamily: PRTase-like (145)

Family: Phosphoribosyltransferases (PRTases) (100)

Protein domain: Adenine PRTase (13)

Human (Homo sapiens) [TaxId: 9606] (4)

1a	d1zn7a_	A:
1b	d1zn7b_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.2020, no name defined] (117)

Human (Homo sapiens) (19)

1a	1zn7A00	A:3-180
1b	1zn7B00	B:3-180

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: PRTase-like (59)

Family: Pribosyltran (59)

Homo sapiens (Human) (7)

1a	Pribosyltran-1zn7B01	B:30-157
1b	Pribosyltran-1zn7B02	B:30-157

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (APT_HUMAN | P07741)

molecular function
	GO:0016208	AMP binding	Interacting selectively and non-covalently with AMP, adenosine monophosphate.
	GO:0002055	adenine binding	Interacting selectively and non-covalently with adenine, a purine base.
	GO:0003999	adenine phosphoribosyltransferase activity	Catalysis of the reaction: AMP + diphosphate = adenine + 5-phospho-alpha-D-ribose 1-diphosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016757	transferase activity, transferring glycosyl groups	Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
biological process
	GO:0044209	AMP salvage	The chemical reactions and pathways resulting in the formation of adenosine monophosphate (AMP) from derivatives of it (either adenine, ADP or adenosine 3',5'-bisphosphate) without de novo synthesis.
	GO:0046083	adenine metabolic process	The chemical reactions and pathways involving adenine, 6-aminopurine, one of the five main bases found in nucleic acids and a component of numerous important derivatives of its corresponding ribonucleoside, adenosine.
	GO:0006168	adenine salvage	Any process that generates adenine, 6-aminopurine, from derivatives of it without de novo synthesis.
	GO:0032869	cellular response to insulin stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
	GO:0007625	grooming behavior	The specific behavior of an organism relating to grooming, cleaning and brushing to remove dirt and parasites.
	GO:0007595	lactation	The regulated release of milk from the mammary glands and the period of time that a mother lactates to feed her young.
	GO:0009116	nucleoside metabolic process	The chemical reactions and pathways involving a nucleoside, a nucleobase linked to either beta-D-ribofuranose (a ribonucleoside) or 2-deoxy-beta-D-ribofuranose, (a deoxyribonucleoside), e.g. adenosine, guanosine, inosine, cytidine, uridine and deoxyadenosine, deoxyguanosine, deoxycytidine and thymidine (= deoxythymidine).
	GO:0006166	purine ribonucleoside salvage	Any process which produces a purine nucleoside from derivatives of it, without de novo synthesis.
	GO:0043101	purine-containing compound salvage	Any process that generates a purine-containing compound, any nucleobase, nucleoside, nucleotide or nucleic acid that contains a purine base, from derivatives of them without de novo synthesis.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ADE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HSX	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PRP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:169 - Pro A:170	[ RasMol ]
		Ala B:169 - Pro B:170	[ RasMol ]
		Asp A:65 - Ser A:66	[ RasMol ]
		Asp B:65 - Ser B:66	[ RasMol ]
		Phe A:19 - Pro A:20	[ RasMol ]
		Phe B:19 - Pro B:20	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1zn7
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	APT_HUMAN \| P07741
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.4.2.7
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	614723
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	APT_HUMAN \| P07741
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	APT_HUMAN \| P07741	:	1opu 1ore 1zn8 1zn9 4x44 4x45

1ore	STRUCTURE OF HUMAN ADENINE PHOSPHORIBOSYLTRANSFERASE
1zn8	SAME PROTEIN COMPLEXED WITH AMP, IN SPACE GROUP P1 AT 1.76 A RESOLUTION
1zn9	SAME PROTEIN IN APO AND AMP COMPLEXED FORMS

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (5, 10)

Sites (10, 10)

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (9, 18)

PROSITE Motifs (1, 2)

Exons (5, 10)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (18, 18)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File