1ZBQ - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 4 IN COMPLEX WITH NAD

Authors :   P. Lukacik, N. Shafqat, K. Kavanagh, J. Bray, F. Von Delft, A. Edwards, C. Arrowsmith, M. Sundstrom, U. Oppermann, Structural Genomics Co (Sgc)

Date :   08 Apr 05 (Deposition) - 26 Apr 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.71

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)
Biol. Unit 3: E,F  (1x)

Keywords :   Short-Chain Dehydrogenase, Hydroxysteroid Dehydrogenase, Peroxisomal Beta-Oxidation, Human, Structural Genomics, Structural Genomics Consortium, Sgc, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. Lukacik, N. Shafqat, K. Kavanagh, J. Bray, F. Von Delft, A. Edwards C. Arrowsmith, M. Sundstrom, U. Oppermann
Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type 4 In Complex With Nad
To Be Published
PubMed: search

Molecule 1 - 17-BETA-HYDROXYSTEROID DEHYDROGENASE 4
	Chains	:	A, B, C, D, E, F
	EC Number	:	1.1.1.35
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	P11 (TORONTO)
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	N-TERMINAL SHORT CHAIN DEHYDROGENASE DOMAIN
	Gene	:	HSD17B4, EDH17B4
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	D-BIFUNCTIONAL PROTEIN, DBP, PEROXISOMAL MULTIFUNCTIONAL ENZYME TYPE 2, MFE-2, 17-BETA-HSD 4, 3-HYDROXYACYL-COA DEHYDROGENASE

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D
Biological Unit 3 (1x)	:					E	F

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 6)

No.	Name	Count	Type	Full Name
1	NAD	6	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	NAD	2	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	NAD	2	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE

Biological Unit 3 (1, 2)

No.	Name	Count	Type	Full Name
1	NAD	2	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:16 , ALA A:19 , GLY A:20 , LEU A:21 , ASN A:39 , ASP A:40 , LEU A:41 , SER A:75 , VAL A:76 , ASN A:99 , ALA A:100 , GLY A:101 , ILE A:102 , HIS A:123 , THR A:149 , SER A:150 , SER A:151 , TYR A:164 , LYS A:168 , PRO A:194 , ASN A:195 , ALA A:196 , SER A:198 , ARG A:199 , MET A:200 , HOH A:1002 , HOH A:1011 , HOH A:1012	BINDING SITE FOR RESIDUE NAD A 1001
2	AC2	SOFTWARE	GLY B:16 , ALA B:19 , GLY B:20 , LEU B:21 , ASN B:39 , ASP B:40 , LEU B:41 , SER B:75 , VAL B:76 , ASN B:99 , ALA B:100 , GLY B:101 , ILE B:102 , VAL B:122 , HIS B:123 , THR B:149 , SER B:150 , SER B:151 , TYR B:164 , LYS B:168 , PRO B:194 , ASN B:195 , ALA B:196 , SER B:198 , ARG B:199 , MET B:200 , THR B:201 , HOH B:1003 , HOH B:1004 , HOH B:1024 , HOH B:1031 , HOH B:1039 , HOH B:1056	BINDING SITE FOR RESIDUE NAD B 1002
3	AC3	SOFTWARE	GLY C:16 , ALA C:19 , GLY C:20 , LEU C:21 , ASN C:39 , ASP C:40 , LEU C:41 , GLY C:43 , SER C:75 , VAL C:76 , ASN C:99 , ALA C:100 , GLY C:101 , HIS C:123 , THR C:149 , SER C:150 , SER C:151 , TYR C:164 , LYS C:168 , PRO C:194 , ASN C:195 , ALA C:196 , SER C:198 , ARG C:199 , MET C:200 , HOH C:1006 , HOH C:1007 , HOH C:1015 , HOH C:1026 , HOH C:1047	BINDING SITE FOR RESIDUE NAD C 1003
4	AC4	SOFTWARE	GLY D:16 , ALA D:19 , GLY D:20 , LEU D:21 , ASN D:39 , ASP D:40 , LEU D:41 , SER D:75 , VAL D:76 , ASN D:99 , ALA D:100 , GLY D:101 , ILE D:102 , HIS D:123 , THR D:149 , SER D:150 , SER D:151 , TYR D:164 , LYS D:168 , PRO D:194 , ASN D:195 , ALA D:196 , SER D:198 , ARG D:199 , MET D:200 , THR D:201 , HOH D:1006 , HOH D:1011 , HOH D:1025	BINDING SITE FOR RESIDUE NAD D 1004
5	AC5	SOFTWARE	GLY E:16 , ALA E:19 , GLY E:20 , LEU E:21 , ASN E:39 , ASP E:40 , LEU E:41 , SER E:75 , VAL E:76 , ASN E:99 , ALA E:100 , GLY E:101 , HIS E:123 , THR E:149 , SER E:150 , SER E:151 , TYR E:164 , LYS E:168 , PRO E:194 , ASN E:195 , ALA E:196 , SER E:198 , ARG E:199 , MET E:200 , THR E:201 , HOH E:1006 , HOH E:1017	BINDING SITE FOR RESIDUE NAD E 1005
6	AC6	SOFTWARE	GLY F:16 , ALA F:19 , GLY F:20 , LEU F:21 , ASN F:39 , ASP F:40 , LEU F:41 , SER F:75 , VAL F:76 , ASN F:99 , ALA F:100 , GLY F:101 , HIS F:123 , THR F:149 , SER F:150 , SER F:151 , TYR F:164 , LYS F:168 , PRO F:194 , ASN F:195 , ALA F:196 , SER F:198 , ARG F:199 , MET F:200 , THR F:201 , HOH F:1007 , HOH F:1012 , HOH F:1026	BINDING SITE FOR RESIDUE NAD F 1006

(no "SS Bond" information available for 1ZBQ)

(no "Cis Peptide Bond" information available for 1ZBQ)

Asymmetric Unit (7, 42)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_037576	G	16	S	DHB4_HUMAN	Disease (DBPD)	137853096	A/B/C/D/E/F	G	16	S
2	UniProt	VAR_052309	F	90	L	DHB4_HUMAN	Polymorphism	28943588	A/B/C/D/E/F	F	90	L
3	UniProt	VAR_014872	R	106	H	DHB4_HUMAN	Polymorphism	25640	A/B/C/D/E/F	R	106	H
4	UniProt	VAR_065906	R	106	P	DHB4_HUMAN	Disease (DBPD)	25640	A/B/C/D/E/F	R	106	P
5	UniProt	VAR_052310	K	140	N	DHB4_HUMAN	Polymorphism	28943589	A/B/C/D/E/F	K	140	N
6	UniProt	VAR_065907	Y	217	C	DHB4_HUMAN	Disease (PRLTS1)	387906825	A/B/C/D/E/F	Y	217	C
7	UniProt	VAR_024625	T	292	S	DHB4_HUMAN	Polymorphism	1143650	A/B/C/D/E/F	T	292	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (7, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_037576	G	16	S	DHB4_HUMAN	Disease (DBPD)	137853096	A/B	G	16	S
2	UniProt	VAR_052309	F	90	L	DHB4_HUMAN	Polymorphism	28943588	A/B	F	90	L
3	UniProt	VAR_014872	R	106	H	DHB4_HUMAN	Polymorphism	25640	A/B	R	106	H
4	UniProt	VAR_065906	R	106	P	DHB4_HUMAN	Disease (DBPD)	25640	A/B	R	106	P
5	UniProt	VAR_052310	K	140	N	DHB4_HUMAN	Polymorphism	28943589	A/B	K	140	N
6	UniProt	VAR_065907	Y	217	C	DHB4_HUMAN	Disease (PRLTS1)	387906825	A/B	Y	217	C
7	UniProt	VAR_024625	T	292	S	DHB4_HUMAN	Polymorphism	1143650	A/B	T	292	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (7, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_037576	G	16	S	DHB4_HUMAN	Disease (DBPD)	137853096	C/D	G	16	S
2	UniProt	VAR_052309	F	90	L	DHB4_HUMAN	Polymorphism	28943588	C/D	F	90	L
3	UniProt	VAR_014872	R	106	H	DHB4_HUMAN	Polymorphism	25640	C/D	R	106	H
4	UniProt	VAR_065906	R	106	P	DHB4_HUMAN	Disease (DBPD)	25640	C/D	R	106	P
5	UniProt	VAR_052310	K	140	N	DHB4_HUMAN	Polymorphism	28943589	C/D	K	140	N
6	UniProt	VAR_065907	Y	217	C	DHB4_HUMAN	Disease (PRLTS1)	387906825	C/D	Y	217	C
7	UniProt	VAR_024625	T	292	S	DHB4_HUMAN	Polymorphism	1143650	C/D	T	292	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (7, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_037576	G	16	S	DHB4_HUMAN	Disease (DBPD)	137853096	E/F	G	16	S
2	UniProt	VAR_052309	F	90	L	DHB4_HUMAN	Polymorphism	28943588	E/F	F	90	L
3	UniProt	VAR_014872	R	106	H	DHB4_HUMAN	Polymorphism	25640	E/F	R	106	H
4	UniProt	VAR_065906	R	106	P	DHB4_HUMAN	Disease (DBPD)	25640	E/F	R	106	P
5	UniProt	VAR_052310	K	140	N	DHB4_HUMAN	Polymorphism	28943589	E/F	K	140	N
6	UniProt	VAR_065907	Y	217	C	DHB4_HUMAN	Disease (PRLTS1)	387906825	E/F	Y	217	C
7	UniProt	VAR_024625	T	292	S	DHB4_HUMAN	Polymorphism	1143650	E/F	T	292	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADH_SHORT	PS00061	Short-chain dehydrogenases/reductases family signature.	DHB4_HUMAN	151-179	6	A:151-179 B:151-179 C:151-179 D:151-179 E:151-179 F:151-179

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADH_SHORT	PS00061	Short-chain dehydrogenases/reductases family signature.	DHB4_HUMAN	151-179	2	A:151-179 B:151-179 - - - -

Biological Unit 2 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADH_SHORT	PS00061	Short-chain dehydrogenases/reductases family signature.	DHB4_HUMAN	151-179	2	- - C:151-179 D:151-179 - -

Biological Unit 3 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADH_SHORT	PS00061	Short-chain dehydrogenases/reductases family signature.	DHB4_HUMAN	151-179	2	- - - - E:151-179 F:151-179

Asymmetric Unit (12, 72)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000256216	1a	ENSE00002062781	chr5:118788138-118788328	191	DHB4_HUMAN	1-20	20	6	A:3-20 B:3-20 C:3-20 D:3-20 E:3-20 F:3-20	18 18 18 18 18 18
1.2b	ENST00000256216	2b	ENSE00001715680	chr5:118792010-118792063	54	DHB4_HUMAN	20-38	19	6	A:20-38 B:20-38 C:20-38 D:20-38 E:20-38 F:20-38	19 19 19 19 19 19
1.4c	ENST00000256216	4c	ENSE00001645814	chr5:118809603-118809710	108	DHB4_HUMAN	38-74	37	6	A:38-74 B:38-74 C:38-74 D:38-74 E:38-74 F:38-74	37 37 37 37 37 37
1.5b	ENST00000256216	5b	ENSE00001703065	chr5:118810096-118810155	60	DHB4_HUMAN	74-94	21	6	A:74-94 B:74-94 C:74-94 D:74-94 E:74-94 F:74-94	21 21 21 21 21 21
1.6b	ENST00000256216	6b	ENSE00001607423	chr5:118811401-118811422	22	DHB4_HUMAN	94-101	8	6	A:94-101 B:94-101 C:94-101 D:94-101 E:94-101 F:94-101	8 8 8 8 8 8
1.7a	ENST00000256216	7a	ENSE00001705604	chr5:118811519-118811565	47	DHB4_HUMAN	101-117	17	6	A:101-117 B:101-117 C:101-117 D:101-117 E:101-117 F:101-117	17 17 17 17 17 17
1.10c	ENST00000256216	10c	ENSE00001647277	chr5:118813112-118813196	85	DHB4_HUMAN	117-145	29	6	A:117-145 B:117-145 C:117-145 D:117-145 E:117-145 F:117-145	29 29 29 29 29 29
1.12f	ENST00000256216	12f	ENSE00001790487	chr5:118814529-118814716	188	DHB4_HUMAN	145-208	64	6	A:145-208 B:145-208 C:145-208 D:145-208 E:145-208 F:145-208	64 64 64 64 64 64
1.13	ENST00000256216	13	ENSE00000972272	chr5:118824887-118824978	92	DHB4_HUMAN	208-238	31	6	A:208-238 B:208-238 C:208-238 D:208-238 E:208-238 F:208-238	31 31 31 31 31 31
1.14	ENST00000256216	14	ENSE00000998891	chr5:118827795-118827819	25	DHB4_HUMAN	239-247	9	6	A:239-247 B:239-247 C:239-247 D:239-247 E:239-247 F:239-247	9 9 9 9 9 9
1.15c	ENST00000256216	15c	ENSE00001143969	chr5:118829513-118829641	129	DHB4_HUMAN	247-290	44	6	A:247-290 B:247-290 C:247-290 D:247-290 E:247-290 F:247-290	44 44 44 44 44 44
1.17c	ENST00000256216	17c	ENSE00001143964	chr5:118832238-118832341	104	DHB4_HUMAN	290-324	35	6	A:290-304 B:290-304 C:290-304 D:290-304 E:290-304 F:290-304	15 15 15 15 15 15
1.18a	ENST00000256216	18a	ENSE00001143958	chr5:118835012-118835248	237	DHB4_HUMAN	325-403	79	0	-	-
1.19b	ENST00000256216	19b	ENSE00001143950	chr5:118837736-118837787	52	DHB4_HUMAN	404-421	18	0	-	-
1.20	ENST00000256216	20	ENSE00001143943	chr5:118842513-118842584	72	DHB4_HUMAN	421-445	25	0	-	-
1.21	ENST00000256216	21	ENSE00001143936	chr5:118844836-118844939	104	DHB4_HUMAN	445-479	35	0	-	-
1.23	ENST00000256216	23	ENSE00001143927	chr5:118850676-118850741	66	DHB4_HUMAN	480-501	22	0	-	-
1.24a	ENST00000256216	24a	ENSE00000972280	chr5:118860911-118860980	70	DHB4_HUMAN	502-525	24	0	-	-
1.25c	ENST00000256216	25c	ENSE00000972281	chr5:118861612-118861718	107	DHB4_HUMAN	525-560	36	0	-	-
1.26a	ENST00000256216	26a	ENSE00000972282	chr5:118862828-118862914	87	DHB4_HUMAN	561-589	29	0	-	-
1.27a	ENST00000256216	27a	ENSE00000972283	chr5:118865589-118865675	87	DHB4_HUMAN	590-618	29	0	-	-
1.28	ENST00000256216	28	ENSE00000972284	chr5:118866961-118867099	139	DHB4_HUMAN	619-665	47	0	-	-
1.29b	ENST00000256216	29b	ENSE00000972285	chr5:118872118-118872245	128	DHB4_HUMAN	665-707	43	0	-	-
1.30i	ENST00000256216	30i	ENSE00001833743	chr5:118877600-118878028	429	DHB4_HUMAN	708-736	29	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:302
 aligned with DHB4_HUMAN | P51659 from UniProtKB/Swiss-Prot  Length:736

    Alignment length:302
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302  
           DHB4_HUMAN     3 SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS 304
               SCOP domains d1zbqa1 A:3-304 Peroxisomal multifunctional enzyme type 2                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 1zbqA01 A:3-246 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                 ---------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee....hhhhhhhhhhhhhh..eeeee............hhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee...........hhhhhhhhhhhhhhhhhhhhh.........eeeee..eeeeeeeee...ee........hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------------S-------------------------------------------------------------------------L---------------H---------------------------------N----------------------------------------------------------------------------C--------------------------------------------------------------------------S------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------P------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: A:151-179    ----------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a         -----------------Exon 1.4c  PDB: A:38-74              -------------------1.6b    ---------------Exon 1.10c  PDB: A:117-145   --------------------------------------------------------------Exon 1.13  PDB: A:208-238      Exon 1.14------------------------------------------Exon 1.17c      Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.2b          -----------------------------------Exon 1.5b            ------Exon 1.7a        ---------------------------Exon 1.12f  PDB: A:145-208 UniProt: 145-208                     --------------------------------------Exon 1.15c  PDB: A:247-290 UniProt: 247-290 -------------- Transcript 1 (2)
                 1zbq A   3 SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS 304
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302

Chain B from PDB  Type:PROTEIN  Length:302
 aligned with DHB4_HUMAN | P51659 from UniProtKB/Swiss-Prot  Length:736

    Alignment length:302
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302  
           DHB4_HUMAN     3 SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS 304
               SCOP domains d1zbqb_ B: Peroxisomal multifunctional enzyme type 2                                                                                                                                                                                                                                                           SCOP domains
               CATH domains 1zbqB01 B:3-246 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                 ---------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee....hhhhhhhhhhhhhh..eeeee............hhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee...........hhhhhhhhhhhhhhhhhhhhh.........eeeee..eeeeeeeee...ee........hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------------S-------------------------------------------------------------------------L---------------H---------------------------------N----------------------------------------------------------------------------C--------------------------------------------------------------------------S------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------P------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: B:151-179    ----------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a         -----------------Exon 1.4c  PDB: B:38-74              -------------------1.6b    ---------------Exon 1.10c  PDB: B:117-145   --------------------------------------------------------------Exon 1.13  PDB: B:208-238      Exon 1.14------------------------------------------Exon 1.17c      Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.2b          -----------------------------------Exon 1.5b            ------Exon 1.7a        ---------------------------Exon 1.12f  PDB: B:145-208 UniProt: 145-208                     --------------------------------------Exon 1.15c  PDB: B:247-290 UniProt: 247-290 -------------- Transcript 1 (2)
                 1zbq B   3 SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS 304
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302

Chain C from PDB  Type:PROTEIN  Length:302
 aligned with DHB4_HUMAN | P51659 from UniProtKB/Swiss-Prot  Length:736

    Alignment length:302
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302  
           DHB4_HUMAN     3 SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS 304
               SCOP domains d1zbqc_ C: Peroxisomal multifunctional enzyme type 2                                                                                                                                                                                                                                                           SCOP domains
               CATH domains 1zbqC01 C:3-246 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                 ---------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee....hhhhhhhhhhhhhh..eeeee............hhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...eeeeeeeee..........hhhhhhhhhhhhhhhhhhhhh.........eeeee..eeeeeeeee...ee........hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------------S-------------------------------------------------------------------------L---------------H---------------------------------N----------------------------------------------------------------------------C--------------------------------------------------------------------------S------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------P------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: C:151-179    ----------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a         -----------------Exon 1.4c  PDB: C:38-74              -------------------1.6b    ---------------Exon 1.10c  PDB: C:117-145   --------------------------------------------------------------Exon 1.13  PDB: C:208-238      Exon 1.14------------------------------------------Exon 1.17c      Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.2b          -----------------------------------Exon 1.5b            ------Exon 1.7a        ---------------------------Exon 1.12f  PDB: C:145-208 UniProt: 145-208                     --------------------------------------Exon 1.15c  PDB: C:247-290 UniProt: 247-290 -------------- Transcript 1 (2)
                 1zbq C   3 SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS 304
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302

Chain D from PDB  Type:PROTEIN  Length:302
 aligned with DHB4_HUMAN | P51659 from UniProtKB/Swiss-Prot  Length:736

    Alignment length:302
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302  
           DHB4_HUMAN     3 SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS 304
               SCOP domains d1zbqd_ D: Peroxisomal multifunctional enzyme type 2                                                                                                                                                                                                                                                           SCOP domains
               CATH domains 1zbqD01 D:3-246 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                 ---------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee....hhhhhhhhhhhhhh..eeeee............hhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhhh...eee.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...eeeeeeeee..........hhhhhhhhhhhhhhhhhhhhh.........eeeee..eeeeeeeee...ee........hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------------S-------------------------------------------------------------------------L---------------H---------------------------------N----------------------------------------------------------------------------C--------------------------------------------------------------------------S------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------P------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: D:151-179    ----------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a         -----------------Exon 1.4c  PDB: D:38-74              -------------------1.6b    ---------------Exon 1.10c  PDB: D:117-145   --------------------------------------------------------------Exon 1.13  PDB: D:208-238      Exon 1.14------------------------------------------Exon 1.17c      Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.2b          -----------------------------------Exon 1.5b            ------Exon 1.7a        ---------------------------Exon 1.12f  PDB: D:145-208 UniProt: 145-208                     --------------------------------------Exon 1.15c  PDB: D:247-290 UniProt: 247-290 -------------- Transcript 1 (2)
                 1zbq D   3 SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS 304
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302

Chain E from PDB  Type:PROTEIN  Length:302
 aligned with DHB4_HUMAN | P51659 from UniProtKB/Swiss-Prot  Length:736

    Alignment length:302
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302  
           DHB4_HUMAN     3 SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS 304
               SCOP domains d1zbqe_ E: Peroxisomal multifunctional enzyme type 2                                                                                                                                                                                                                                                           SCOP domains
               CATH domains 1zbqE01 E:3-246 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                 ---------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee....hhhhhhhhhhhhhh..eeeee............hhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...eeeeeeeee..........hhhhhhhhhhhhhhhhhhhhh.........eeeee..eeeeeeeee...ee........hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------------S-------------------------------------------------------------------------L---------------H---------------------------------N----------------------------------------------------------------------------C--------------------------------------------------------------------------S------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------P------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: E:151-179    ----------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a         -----------------Exon 1.4c  PDB: E:38-74              -------------------1.6b    ---------------Exon 1.10c  PDB: E:117-145   --------------------------------------------------------------Exon 1.13  PDB: E:208-238      Exon 1.14------------------------------------------Exon 1.17c      Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.2b          -----------------------------------Exon 1.5b            ------Exon 1.7a        ---------------------------Exon 1.12f  PDB: E:145-208 UniProt: 145-208                     --------------------------------------Exon 1.15c  PDB: E:247-290 UniProt: 247-290 -------------- Transcript 1 (2)
                 1zbq E   3 SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS 304
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302

Chain F from PDB  Type:PROTEIN  Length:302
 aligned with DHB4_HUMAN | P51659 from UniProtKB/Swiss-Prot  Length:736

    Alignment length:302
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302  
           DHB4_HUMAN     3 SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS 304
               SCOP domains d1zbqf_ F: Peroxisomal multifunctional enzyme type 2                                                                                                                                                                                                                                                           SCOP domains
               CATH domains 1zbqF01 F:3-246 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                 ---------------------------------------------------------- CATH domains
           Pfam domains (1) -------adh_short-1zbqF01 F:10-183                                                                                                                                                    ------------------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -------adh_short-1zbqF02 F:10-183                                                                                                                                                    ------------------------------------------------------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) -------adh_short-1zbqF03 F:10-183                                                                                                                                                    ------------------------------------------------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) -------adh_short-1zbqF04 F:10-183                                                                                                                                                    ------------------------------------------------------------------------------------------------------------------------- Pfam domains (4)
           Pfam domains (5) -------adh_short-1zbqF05 F:10-183                                                                                                                                                    ------------------------------------------------------------------------------------------------------------------------- Pfam domains (5)
           Pfam domains (6) -------adh_short-1zbqF06 F:10-183                                                                                                                                                    ------------------------------------------------------------------------------------------------------------------------- Pfam domains (6)
         Sec.struct. author ........eeee....hhhhhhhhhhhhhh..eeeee............hhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhhh...eee.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee...........hhhhhhhhhhhhhhhhhhhhh.........eeeee..eeeeeeeee...ee........hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------------S-------------------------------------------------------------------------L---------------H---------------------------------N----------------------------------------------------------------------------C--------------------------------------------------------------------------S------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------P------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: F:151-179    ----------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a         -----------------Exon 1.4c  PDB: F:38-74              -------------------1.6b    ---------------Exon 1.10c  PDB: F:117-145   --------------------------------------------------------------Exon 1.13  PDB: F:208-238      Exon 1.14------------------------------------------Exon 1.17c      Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.2b          -----------------------------------Exon 1.5b            ------Exon 1.7a        ---------------------------Exon 1.12f  PDB: F:145-208 UniProt: 145-208                     --------------------------------------Exon 1.15c  PDB: F:247-290 UniProt: 247-290 -------------- Transcript 1 (2)
                 1zbq F   3 SPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDS 304
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: NAD(P)-binding Rossmann-fold domains (1604)

Superfamily: NAD(P)-binding Rossmann-fold domains (1604)

Family: Tyrosine-dependent oxidoreductases (503)

Protein domain: Peroxisomal multifunctional enzyme type 2 (1)

Human (Homo sapiens) [TaxId: 9606] (1)

1a	d1zbqa1	A:3-304
1b	d1zbqb_	B:
1c	d1zbqc_	C:
1d	d1zbqd_	D:
1e	d1zbqe_	E:
1f	d1zbqf_	F:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: NAD(P)-binding Rossmann-like Domain (1244)

Human (Homo sapiens) (188)

1a	1zbqA01	A:3-246
1b	1zbqB01	B:3-246
1c	1zbqC01	C:3-246
1d	1zbqD01	D:3-246
1e	1zbqE01	E:3-246
1f	1zbqF01	F:3-246

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: NADP_Rossmann (1239)

Family: adh_short (92)

Homo sapiens (Human) (21)

1a	adh_short-1zbqF01	F:10-183
1b	adh_short-1zbqF02	F:10-183
1c	adh_short-1zbqF03	F:10-183
1d	adh_short-1zbqF04	F:10-183
1e	adh_short-1zbqF05	F:10-183
1f	adh_short-1zbqF06	F:10-183

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (DHB4_HUMAN | P51659)

molecular function
	GO:0044594	17-beta-hydroxysteroid dehydrogenase (NAD+) activity	Catalysis of the reaction: a 17-beta-hydroxysteroid + NAD+ = a 17-oxosteroid + NADH + H+.
	GO:0003857	3-hydroxyacyl-CoA dehydrogenase activity	Catalysis of the reaction: (S)-3-hydroxyacyl-CoA + NAD+ = 3-oxoacyl-CoA + NADH + H(+).
	GO:0033989	3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase activity	Catalysis of the reaction: (24R,25R)-3alpha,7alpha,12alpha,24-tetrahydroxy-5beta-cholestanoyl-CoA = (24E)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA + H2O.
	GO:0016853	isomerase activity	Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
	GO:0016508	long-chain-enoyl-CoA hydratase activity	Catalysis of the reaction: a long-chain (3S)-3-hydroxyacyl-CoA = a long-chain trans-2-enoyl-CoA + H2O. A long-chain acyl-CoA is an acyl-CoA thioester where the acyl chain contains 13 to 22 carbon atoms.
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
biological process
	GO:0060009	Sertoli cell development	The process whose specific outcome is the progression of a Sertoli cell over time, from its formation to the mature structure. Cell development does not include the steps involved in committing a cell to a Sertoli cell fate.
	GO:0036109	alpha-linolenic acid metabolic process	The chemical reactions and pathways involving alpha-linolenic acid, an unsaturated omega-6 fatty acid that has the molecular formula C18H32O2.
	GO:0008209	androgen metabolic process	The chemical reactions and pathways involving androgens, C19 steroid hormones that can stimulate the development of male sexual characteristics.
	GO:0006699	bile acid biosynthetic process	The chemical reactions and pathways resulting in the formation of bile acids, any of a group of steroid carboxylic acids occurring in bile.
	GO:0008210	estrogen metabolic process	The chemical reactions and pathways involving estrogens, C18 steroid hormones that can stimulate the development of female sexual characteristics. Also found in plants.
	GO:0006635	fatty acid beta-oxidation	A fatty acid oxidation process that results in the complete oxidation of a long-chain fatty acid. Fatty acid beta-oxidation begins with the addition of coenzyme A to a fatty acid, and occurs by successive cycles of reactions during each of which the fatty acid is shortened by a two-carbon fragment removed as acetyl coenzyme A; the cycle continues until only two or three carbons remain (as acetyl-CoA or propionyl-CoA respectively).
	GO:0033540	fatty acid beta-oxidation using acyl-CoA oxidase	A fatty acid beta-oxidation pathway in which the initial step, which converts an acyl-CoA to a trans-2-enoyl-CoA, is catalyzed by acyl-CoA oxidase; the electrons removed by oxidation pass directly to oxygen and produce hydrogen peroxide, which is cleaved by peroxisomal catalases. Fatty acid beta-oxidation begins with the addition of coenzyme A to a fatty acid, and ends when only two or three carbons remain (as acetyl-CoA or propionyl-CoA respectively).
	GO:0006631	fatty acid metabolic process	The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0036112	medium-chain fatty-acyl-CoA metabolic process	The chemical reactions and pathways involving medium-chain fatty-acyl-CoAs, any derivative of coenzyme A in which the sulfhydryl group is in a thioester linkage with a long-chain fatty-acyl group. A medium-chain fatty acid is a fatty acid with a chain length of between C6 and C12.
	GO:0001649	osteoblast differentiation	The process whereby a relatively unspecialized cell acquires the specialized features of an osteoblast, a mesodermal or neural crest cell that gives rise to bone.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0000038	very long-chain fatty acid metabolic process	The chemical reactions and pathways involving a fatty acid which has a chain length greater than C22.
	GO:0036111	very long-chain fatty-acyl-CoA metabolic process	The chemical reactions and pathways involving very long-chain fatty-acyl-CoAs, any derivative of coenzyme A in which the sulfhydryl group is in a thioester linkage with a medium-chain fatty-acyl group. A very long-chain fatty acid is a fatty acid which has a chain length greater than C22.
cellular component
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005782	peroxisomal matrix	The volume contained within the membranes of a peroxisome; in many cells the matrix contains a crystalloid core largely composed of urate oxidase.
	GO:0005778	peroxisomal membrane	The lipid bilayer surrounding a peroxisome.
	GO:0005777	peroxisome	A small organelle enclosed by a single membrane, and found in most eukaryotic cells. Contains peroxidases and other enzymes involved in a variety of metabolic processes including free radical detoxification, lipid catabolism and biosynthesis, and hydrogen peroxide metabolism.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1zbq)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1zbq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DHB4_HUMAN \| P51659
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.35
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	233400
		Disease Information	:	OMIM
	261515
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	DHB4_HUMAN \| P51659
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	DHB4_HUMAN \| P51659	:	1ikt 1s9c

(no "Related Entries Specified in the PDB File" available for 1ZBQ)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (7, 42)

PROSITE Motifs (1, 6)

Exons (12, 72)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (1, 6)

Pfam Domains (1, 6)

Gene Ontology (30, 30)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File