1Z3S - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   ANGIOPOIETIN-2 RECEPTOR BINDING DOMAIN

Authors :   W. A. Barton, D. Tzvetkova, D. B. Nikolov

Date :   14 Mar 05 (Deposition) - 12 Jul 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.35

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Angiogenesis, Tie2 Binding, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   W. A. Barton, D. Tzvetkova, D. B. Nikolov
Structure Of The Angiopoietin-2 Receptor Binding Domain And Identification Of Surfaces Involved In Tie2 Recognition.
Structure V. 13 825 2005
PubMed-ID: 15893672 | Reference-DOI: 10.1016/J.STR.2005.03.009
(for further references see the PDB file header)

Molecule 1 - ANGIOPOIETIN-2
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	RECEPTOR BINDING DOMAIN (RESIDUES 281-496)
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	ANG-2

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	CA	2	Ligand/Ion	CALCIUM ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:429 , ASP A:431 , CYS A:433 , CYS A:435	BINDING SITE FOR RESIDUE CA A 497
2	AC2	SOFTWARE	ASP B:429 , ASP B:431 , CYS B:433 , CYS B:435	BINDING SITE FOR RESIDUE CA B 497

Asymmetric Unit

No.	Residues
1	A:284	-	A:313
2	A:433	-	A:435
3	A:437	-	A:450
4	B:284	-	B:313
5	B:433	-	B:435
6	B:437	-	B:450

(no "Cis Peptide Bond" information available for 1Z3S)

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049069	V	333	I	ANGP2_HUMAN	Polymorphism	7813215	A/B	V	333	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049069	V	333	I	ANGP2_HUMAN	Polymorphism	7813215	A	V	333	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049069	V	333	I	ANGP2_HUMAN	Polymorphism	7813215	B	V	333	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FIBRINOGEN_C_1	PS00514	Fibrinogen C-terminal domain signature.	ANGP2_HUMAN	445-457	2	A:445-457 B:445-457

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FIBRINOGEN_C_1	PS00514	Fibrinogen C-terminal domain signature.	ANGP2_HUMAN	445-457	1	A:445-457 -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FIBRINOGEN_C_1	PS00514	Fibrinogen C-terminal domain signature.	ANGP2_HUMAN	445-457	1	- B:445-457

Asymmetric Unit (5, 10)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000325203	1a	ENSE00001949798	chr8:6420930-6420168	763	ANGP2_HUMAN	1-96	96	0	-	-
1.2	ENST00000325203	2	ENSE00000924724	chr8:6390008-6389853	156	ANGP2_HUMAN	97-148	52	0	-	-
1.3	ENST00000325203	3	ENSE00000924725	chr8:6385197-6385076	122	ANGP2_HUMAN	149-189	41	0	-	-
1.4	ENST00000325203	4	ENSE00000924726	chr8:6378931-6378699	233	ANGP2_HUMAN	189-267	79	0	-	-
1.5a	ENST00000325203	5a	ENSE00001121511	chr8:6377515-6377385	131	ANGP2_HUMAN	267-310	44	2	A:280-310 B:280-310	31 31
1.6	ENST00000325203	6	ENSE00000979541	chr8:6372299-6372198	102	ANGP2_HUMAN	311-344	34	2	A:311-344 B:311-344	34 34
1.7	ENST00000325203	7	ENSE00001121499	chr8:6371365-6371199	167	ANGP2_HUMAN	345-400	56	2	A:345-400 B:345-400	56 56
1.8a	ENST00000325203	8a	ENSE00000979543	chr8:6366583-6366453	131	ANGP2_HUMAN	400-444	45	2	A:400-444 B:400-444	45 45
1.9c	ENST00000325203	9c	ENSE00001854410	chr8:6360782-6357172	3611	ANGP2_HUMAN	444-496	53	2	A:444-495 B:444-495	52 52

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:216
 aligned with ANGP2_HUMAN | O15123 from UniProtKB/Swiss-Prot  Length:496

    Alignment length:216
                                   289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489      
          ANGP2_HUMAN   280 SFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPAD 495
               SCOP domains d1z3sa_ A: automated matches                                                                                                                                                                                             SCOP domains
               CATH domains 1z3sA01 A:280-410,A:486-495 Gamma Fibrinogen, chain A, domain 1                                                                    1z3sA02 A:411-485 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2    1z3sA01    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhh......eeeeee......eeeeeee.......eeeeeee.........hhhhhhhh..........hhhhhhhhhhhh.eeeeeeee.....eeeeeeeeeee.hhhhh..eeeeeeee...........................hhhhhhh..........ee..................eehhhhh......eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------I------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------FIBRINOGEN_C_-------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: A:280-310      Exon 1.6  PDB: A:311-344          Exon 1.7  PDB: A:345-400 UniProt: 345-400               -------------------------------------------Exon 1.9c  PDB: A:444-495 UniProt: 444-496           Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------Exon 1.8a  PDB: A:400-444 UniProt: 400-444   --------------------------------------------------- Transcript 1 (2)
                 1z3s A 280 EFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPAD 495
                                   289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489

Chain B from PDB  Type:PROTEIN  Length:216
 aligned with ANGP2_HUMAN | O15123 from UniProtKB/Swiss-Prot  Length:496

    Alignment length:216
                                   289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489      
          ANGP2_HUMAN   280 SFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPAD 495
               SCOP domains d1z3sb_ B: automated matches                                                                                                                                                                                             SCOP domains
               CATH domains 1z3sB01 B:280-410,B:486-495 Gamma Fibrinogen, chain A, domain 1                                                                    1z3sB02 B:411-485 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2    1z3sB01    CATH domains
           Pfam domains (1) -Fibrinogen_C-1z3sB01 B:281-494                                                                                                                                                                                        - Pfam domains (1)
           Pfam domains (2) -Fibrinogen_C-1z3sB02 B:281-494                                                                                                                                                                                        - Pfam domains (2)
         Sec.struct. author ...hhhhhhh......eeeeee......eeeeeee.......eeeeeee.........hhhhhhhh..........hhhhhhhhhhhh.eeeeeeee.....eeeeeeeeeee.hhhhh..eeeeeeee...........................hhhhhhh..........ee..................eehhhhh......eeeeeee... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------I------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------FIBRINOGEN_C_-------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: B:280-310      Exon 1.6  PDB: B:311-344          Exon 1.7  PDB: B:345-400 UniProt: 345-400               -------------------------------------------Exon 1.9c  PDB: B:444-495 UniProt: 444-496           Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------Exon 1.8a  PDB: B:400-444 UniProt: 400-444   --------------------------------------------------- Transcript 1 (2)
                 1z3s B 280 EFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPAD 495
                                   289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Fibrinogen C-terminal domain-like (70)

Superfamily: Fibrinogen C-terminal domain-like (70)

Family: automated matches (27)

Protein domain: automated matches (27)

Human (Homo sapiens) [TaxId: 9606] (27)

1a	d1z3sa_	A:
1b	d1z3sb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Gamma Fibrinogen; Chain A, domain 1 (58)

Homologous Superfamily: Gamma Fibrinogen, chain A, domain 1 (58)

Human (Homo sapiens) (53)

1a	1z3sA01	A:280-410,A:486-495
1b	1z3sB01	B:280-410,B:486-495

Class: Few Secondary Structures (1120)

Architecture: Irregular (1120)

Topology: Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 (58)

Homologous Superfamily: Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 (58)

Human (Homo sapiens) (53)

2a	1z3sA02	A:411-485
2b	1z3sB02	B:411-485

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Fibrinogen_C (23)

Family: Fibrinogen_C (23)

Homo sapiens (Human) (19)

1a	Fibrinogen_C-1z3sB01	B:281-494
1b	Fibrinogen_C-1z3sB02	B:281-494

Asymmetric Unit(hide GO term definitions)

Chain A,B (ANGP2_HUMAN | O15123)

molecular function
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0030971	receptor tyrosine kinase binding	Interacting selectively and non-covalently with a receptor that possesses protein tyrosine kinase activity.
biological process
	GO:0048014	Tie signaling pathway	The series of molecular signals generated as a consequence of a Tie protein (a receptor) binding to one of its physiological ligands (an angiopoietin).
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0031100	animal organ regeneration	The regrowth of a lost or destroyed animal organ.
	GO:0048514	blood vessel morphogenesis	The process in which the anatomical structures of blood vessels are generated and organized. The blood vessel is the vasculature carrying blood.
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0071363	cellular response to growth factor stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a growth factor stimulus.
	GO:0007281	germ cell development	The process whose specific outcome is the progression of an immature germ cell over time, from its formation to the mature structure (gamete). A germ cell is any reproductive cell in a multicellular organism.
	GO:0072012	glomerulus vasculature development	The biological process whose specific outcome is the progression of a glomerulus vasculature from an initial condition to its mature state. This process begins with the formation of the glomerulus vasculature and ends with the mature structure. The glomerulus vasculature is composed of the tubule structures that carry blood or lymph in the glomerulus.
	GO:0050900	leukocyte migration	The movement of a leukocyte within or between different tissues and organs of the body.
	GO:0060135	maternal process involved in female pregnancy	A reproductive process occurring in the mother that allows an embryo or fetus to develop within it.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0016525	negative regulation of angiogenesis	Any process that stops, prevents, or reduces the frequency, rate or extent of angiogenesis.
	GO:0043537	negative regulation of blood vessel endothelial cell migration	Any process that stops, prevents, or reduces the frequency, rate or extent of the migration of the endothelial cells of blood vessels.
	GO:0010812	negative regulation of cell-substrate adhesion	Any process that decreases the frequency, rate or extent of cell-substrate adhesion. Cell-substrate adhesion is the attachment of a cell to the underlying substrate via adhesion molecules.
	GO:0050928	negative regulation of positive chemotaxis	Any process that stops, prevents, or reduces the frequency, rate or extent of the directed movement of a motile cell or organism towards a higher concentration in a concentration gradient of a specific chemical.
	GO:0045766	positive regulation of angiogenesis	Any process that activates or increases angiogenesis.
	GO:0014823	response to activity	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an activity stimulus.
	GO:0009749	response to glucose	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
	GO:0001666	response to hypoxia	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:0009612	response to mechanical stimulus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mechanical stimulus.
	GO:0014070	response to organic cyclic compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0009314	response to radiation	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an electromagnetic radiation stimulus. Electromagnetic radiation is a propagating wave in space with electric and magnetic components. These components oscillate at right angles to each other and to the direction of propagation.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1z3s)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1z3s
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ANGP2_HUMAN \| O15123
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ANGP2_HUMAN \| O15123
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ANGP2_HUMAN \| O15123	:	1z3u 2gy7 4jzc 4zfg

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (6, 6)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (1, 2)

Exons (5, 10)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (2, 4)

Pfam Domains (1, 2)

Gene Ontology (32, 32)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File