|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1Z1X) |
Sites (0, 0)| (no "Site" information available for 1Z1X) |
SS Bonds (4, 4)
Asymmetric Unit
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1Z1X) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1Z1X) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1Z1X) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:64 aligned with DID_ECHCA | Q5EE07 from UniProtKB/Swiss-Prot Length:64 Alignment length:64 10 20 30 40 50 60 DID_ECHCA 1 NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRAMLDGLHDYCTGVTSDCPRNRYNH 64 SCOP domains ---------------------------------------------------------------- SCOP domains CATH domains 1z1xA00 A:1-64 Echistatin CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE (1) DISINTEGRIN_2 PDB: A:1-64 UniProt: 1-64 PROSITE (1) PROSITE (2) -------------------DISINTEGRIN_1 ------------------------- PROSITE (2) Transcript ---------------------------------------------------------------- Transcript 1z1x A 1 NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRAMLDGLHDYCTGVTSDCPRNRYNH 64 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 1Z1X) |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1Z1X) |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A (DID_ECHCA | Q5EE07)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|