Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF BACILLUS SUBTILIS PROTEIN YSNE: THE NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET SR220
 
Authors :  G. Liu, L. Ma, Y. Shen, R. Xiao, T. Acton, G. T. Montelione, T. Szyperski, Northeast Structural Genomics Consortium (Nesg)
Date :  18 Feb 05  (Deposition) - 29 Mar 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Nesg, Gft Nmr, Structral Genomics, Sr220, Structural Genomics, Psi, Protein Structure Initiative, Northeast Structural Genomics Consortium, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Liu, L. Ma, Y. Shen, R. Xiao, T. Acton, G. T. Montelione, T. Szyperski
Solution Structure Of Bacillus Subtilis Protein Ysne
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN YSNE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneYSNE
    Organism ScientificBACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168
    Organism Taxid224308
    StrainSUBSP. SUBTILIS STR. 168

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1YX0)

(-) Sites  (0, 0)

(no "Site" information available for 1YX0)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YX0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1YX0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1YX0)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GNATPS51186 Gcn5-related N-acetyltransferase (GNAT) domain profile.YSNE_BACSU3-151  1A:3-151

(-) Exons   (0, 0)

(no "Exon" information available for 1YX0)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:151
 aligned with YSNE_BACSU | P94562 from UniProtKB/Swiss-Prot  Length:151

    Alignment length:151
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150 
           YSNE_BACSU     1 MHIKIDDLTGRQVVSLVNEHLHSMTLMSPPESIHALGLEKLRGPEITFWSAWEGDELAGCGALKELDTRHGEIKSMRTSASHLRKGVAKQVLQHIIEEAEKRGYERLSLETGSMASFEPARKLYESFGFQYCEPFADYGEDPNSVFMTKKL 151
               SCOP domains d1yx0a1 A:1-151 Hypothetical protein YsnE                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------Acetyltransf_1-1yx0A01 A:51-130                                                 --------------------- Pfam domains
         Sec.struct. author ..eeee...hhhhhhhhhhh................hhhhhh....eeeeee....eeeeeeeeeee..eee.............hhhhhhhhhhhhhhhhhh...ee.......hhhhhhhhhhh..eee...............eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --GNAT  PDB: A:3-151 UniProt: 3-151                                                                                                                     PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yx0 A   1 MHIKIDDLTGRQVVSLVNEHLHSMTLMSPPESIHALGLEKLRGPEITFWSAWEGDELAGCGALKELDTRHGEIKSMRTSASHLRKGVAKQVLQHIIEEAEKRGYERLSLETGSMASFEPARKLYESFGFQYCEPFADYGEDPNSVFMTKKL 151
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1YX0)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A   (YSNE_BACSU | P94562)
molecular function
    GO:0008080    N-acetyltransferase activity    Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
    GO:0004596    peptide alpha-N-acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + peptide = CoA + N-alpha-acetylpeptide. This reaction is the acetylation of the N-terminal amino acid residue of a peptide or protein.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
    GO:0006474    N-terminal protein amino acid acetylation    The acetylation of the N-terminal amino acid of proteins.
cellular component
    GO:0031248    protein acetyltransferase complex    A complex that catalyzes the transfer of an acetyl group to a protein acceptor molecule.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1yx0)
 
  Sites
(no "Sites" information available for 1yx0)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1yx0)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1yx0
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  YSNE_BACSU | P94562
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  YSNE_BACSU | P94562
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1YX0)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1YX0)