Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A NITROREDUCTASE FAMILY PROTEIN FROM BACILLUS CEREUS ATCC 14579
 
Authors :  Midwest Center For Structural Genomics (Mcsg)
Date :  18 Feb 05  (Deposition) - 12 Apr 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Bacillus Cereus, Nitroreductase Family Protein, Fmn, Structural Genomics, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Zhang, H. Li, F. Collart, S. Moy, A. Joachimiak
Crystal Structure Of A Nitroreductase Family Protein From Bacillus Cereus Atcc 14579
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - NITROREDUCTASE FAMILY PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET15B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism ScientificBACILLUS CEREUS ATCC 14579
    Organism Taxid226900
    StrainATCC 14579 / DSM 31

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1FMN1Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:15 , ARG A:16 , SER A:17 , ARG A:19 , PRO A:43 , THR A:44 , SER A:45 , ARG A:87 , TRP A:124 , GLN A:127 , TRP A:137 , LEU A:149 , GLN A:150 , HIS A:151 , ARG A:188 , HOH A:311 , HOH A:334 , HOH A:343BINDING SITE FOR RESIDUE FMN A 201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YWQ)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Asn A:153 -Pro A:154

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1YWQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1YWQ)

(-) Exons   (0, 0)

(no "Exon" information available for 1YWQ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:199
 aligned with Q81EW9_BACCR | Q81EW9 from UniProtKB/TrEMBL  Length:200

    Alignment length:199
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191         
         Q81EW9_BACCR     2 SATTTNLKEAIVNRRSIRKVTKNDAITKERIEEVLKTALHAPTSFNMQSGRMVVLMDGEHEKFWDIVKETLRARVPAENFEATVERLKGFHAGVGTVLFFEDQATVEKMQENAPLYKDQFPFWSHQGNAMLQHTVWMLLSAEGIGASLQHYNPIVDAEVKETWNIPAEWSLVGQMPFGEPNEQPAERTFLPTEDVVKFY 200
               SCOP domains d1ywqa1 A:2-200 Hypothetical oxidoreductase BC1844                                                                                                                                                      SCOP domains
               CATH domains 1ywqA00 A:2-200 NADH Oxidase                                                                                                                                                                            CATH domains
               Pfam domains ----------Nitroreductase-1ywqA01 A:12-180                                                                                                                                          -------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhh.....ee.....hhhhhhhhhhhhh...hhhhh..eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh..eeeeeeeehhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..ee........hhhhhhhhh.....eeeeeeeeeeee..........hhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ywq A   2 SATTTNLKEAIVNRRSIRKVTKNDAITKERIEEVLKTALHAPTSFNMQSGRMVVLMDGEHEKFWDIVKETLRARVPAENFEATVERLKGFHAGVGTVLFFEDQATVEKMQENAPLYKDQFPFWSHQGNAMLQHTVWMLLSAEGIGASLQHYNPIVDAEVKETWNIPAEWSLVGQMPFGEPNEQPAERTFLPTEDVVKFY 200
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric Unit

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q81EW9_BACCR | Q81EW9)
molecular function
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:153 - Pro A:154   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ywq
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q81EW9_BACCR | Q81EW9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q81EW9_BACCR | Q81EW9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1YWQ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1YWQ)