1YRE - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   HYPOTHETICAL PROTEIN PA3270 FROM PSEUDOMONAS AERUGINOSA IN COMPLEX WITH COA

Authors :   V. V. Lunin, J. Osipiuk, A. Savchenko, A. M. Edwards, A. Joachimiak, Mid Center For Structural Genomics (Mcsg)

Date :   03 Feb 05 (Deposition) - 15 Feb 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.15

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Apc5563, Pa3270, Midwest Center For Structural Genomics, Mscg, Protein Structure Initiative, Psi, Mcsg, Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   V. V. Lunin, T. Skarina, J. Osipiuk, A. Joachimiak, A. M. Edwards, A. Savchenko
The Crystal Structure Of Hypothetical Protein Pa3270 From Pseudomonas Aeruginosa In Complex With Coa
To Be Published
PubMed: search

Molecule 1 - HYPOTHETICAL PROTEIN PA3270
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	MODIFIED PET15B
	Expression System Strain	:	BL21 DE3
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Organism Scientific	:	PSEUDOMONAS AERUGINOSA
	Organism Taxid	:	208964
	Strain	:	PAO1

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	COA	4	Ligand/Ion	COENZYME A

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	COA	2	Ligand/Ion	COENZYME A

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	COA	2	Ligand/Ion	COENZYME A

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ALA A:43 , MET A:47 , THR A:100 , TRP A:101 , LEU A:102 , HIS A:107 , GLY A:108 , ASN A:112 , ASN A:140 , LEU A:141 , ARG A:142 , GLY A:145 , ALA A:146 , LYS A:149 , HOH A:628 , HOH A:639 , HOH A:647 , HOH A:660 , HOH A:663	BINDING SITE FOR RESIDUE COA A 601
2	AC2	SOFTWARE	ALA B:43 , MET B:47 , THR B:100 , TRP B:101 , LEU B:102 , HIS B:107 , GLY B:108 , ASN B:112 , SER B:135 , ASN B:140 , LEU B:141 , ARG B:142 , GLY B:145 , ALA B:146 , HOH B:610 , HOH B:645 , HOH B:668 , HOH B:669 , HOH B:701 , ARG C:57 , GLN C:184	BINDING SITE FOR RESIDUE COA B 602
3	AC3	SOFTWARE	ALA C:43 , MET C:47 , THR C:100 , TRP C:101 , LEU C:102 , HIS C:107 , GLY C:108 , ASN C:112 , THR C:136 , ASN C:140 , LEU C:141 , ARG C:142 , GLY C:145 , ALA C:146 , LYS C:149 , HOH C:630 , HOH C:679 , HOH C:683 , HOH C:687 , HOH C:707	BINDING SITE FOR RESIDUE COA C 603
4	AC4	SOFTWARE	GLN A:184 , ALA D:43 , MET D:47 , THR D:100 , TRP D:101 , LEU D:102 , HIS D:107 , GLY D:108 , ASN D:112 , SER D:135 , THR D:136 , ASN D:140 , ARG D:142 , GLY D:145 , ALA D:146 , LYS D:149 , HOH D:649 , HOH D:650 , HOH D:656 , HOH D:662 , HOH D:664 , HOH D:686	BINDING SITE FOR RESIDUE COA D 604

(no "SS Bond" information available for 1YRE)

Asymmetric Unit

No.	Residues
1	Leu A:92	-	Pro A:93
2	Leu B:92	-	Pro B:93
3	Leu C:92	-	Pro C:93
4	Leu D:92	-	Pro D:93

(no "SAP(SNP)/Variant" information available for 1YRE)

(no "PROSITE Motif" information available for 1YRE)

(no "Exon" information available for 1YRE)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:183
 aligned with Q9HYX1_PSEAE | Q9HYX1 from UniProtKB/TrEMBL  Length:195

    Alignment length:183
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190   
         Q9HYX1_PSEAE    11 LPITLQRGALRLEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLAEQREGRALPLAVRLGVQLVGTTRFAEFLPALPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLAGGRLDDTFVYSITDHEWPQVKAALEASF 193
               SCOP domains d1yrea1 A:11-193 Hypothetical protein PA3270                                                                                                                                            SCOP domains
               CATH domains 1yreA00 A:11-193  [code=3.40.630.30, no name defined]                                                                                                                                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee..eeeee.hhhhhhhhhhhhhh............hhhhhhhhhhhhhh..eeeeeeee..eeeeeeeeeeee....eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh....eeeeeee..hhhhhhhhhhh..eeeeeeeeeee.....eeeeeeeeee..hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yre A  11 LPITLQRGALRLEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLAEQREGRALPLAVRLGVQLVGTTRFAEFLPALPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLAGGRLDDTFVYSITDHEWPQVKAALEASF 193
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190

Chain B from PDB  Type:PROTEIN  Length:187
 aligned with Q9HYX1_PSEAE | Q9HYX1 from UniProtKB/TrEMBL  Length:195

    Alignment length:187
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       
         Q9HYX1_PSEAE     8 FKPLPITLQRGALRLEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLAEQREGRALPLAVRLGVQLVGTTRFAEFLPALPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLAGGRLDDTFVYSITDHEWPQVKAALEASFT 194
               SCOP domains d1yreb_ B: automated matches                                                                                                                                                                SCOP domains
               CATH domains 1yreB00 B:8-194  [code=3.40.630.30, no name defined]                                                                                                                                        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eee..eeeee.hhhhhhhhhhhhhhh...........hhhhhhhhhhhhhh..eeeeeeee..eeeeeeeeeeee....eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh....eeeeeee..hhhhhhhhhhhh.eeeeeeeeeee.....eeeeeeeeee..hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yre B   8 FKPLPITLQRGALRLEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLAEQREGRALPLAVRLGVQLVGTTRFAEFLPALPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLAGGRLDDTFVYSITDHEWPQVKAALEASFT 194
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187

Chain C from PDB  Type:PROTEIN  Length:182
 aligned with Q9HYX1_PSEAE | Q9HYX1 from UniProtKB/TrEMBL  Length:195

    Alignment length:182
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191  
         Q9HYX1_PSEAE    12 PITLQRGALRLEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLAEQREGRALPLAVRLGVQLVGTTRFAEFLPALPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLAGGRLDDTFVYSITDHEWPQVKAALEASF 193
               SCOP domains d1yrec_ C: automated matches                                                                                                                                                           SCOP domains
               CATH domains 1yreC00 C:12-193  [code=3.40.630.30, no name defined]                                                                                                                                  CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee..eeeee.hhhhhhhhhhhhhhh...........hhhhhhhhhhhhhh..eeeeeeee..eeeeeeeeeeee....eeeeeeeee.hhhh..hhhhhhhhhhhhhhhh.....eeeeeee..hhhhhhhhhhh..eeeeeeeeeee.....eeeeeeeeee..hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yre C  12 PITLQRGALRLEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLAEQREGRALPLAVRLGVQLVGTTRFAEFLPALPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLAGGRLDDTFVYSITDHEWPQVKAALEASF 193
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191

Chain D from PDB  Type:PROTEIN  Length:187
 aligned with Q9HYX1_PSEAE | Q9HYX1 from UniProtKB/TrEMBL  Length:195

    Alignment length:187
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       
         Q9HYX1_PSEAE     8 FKPLPITLQRGALRLEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLAEQREGRALPLAVRLGVQLVGTTRFAEFLPALPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLAGGRLDDTFVYSITDHEWPQVKAALEASFT 194
               SCOP domains d1yred_ D: automated matches                                                                                                                                                                SCOP domains
               CATH domains 1yreD00 D:8-194  [code=3.40.630.30, no name defined]                                                                                                                                        CATH domains
           Pfam domains (1) -----------Acetyltransf_3-1yreD01 D:19-153                                                                                                        ----------------------------------------- Pfam domains (1)
           Pfam domains (2) -----------Acetyltransf_3-1yreD02 D:19-153                                                                                                        ----------------------------------------- Pfam domains (2)
           Pfam domains (3) -----------Acetyltransf_3-1yreD03 D:19-153                                                                                                        ----------------------------------------- Pfam domains (3)
           Pfam domains (4) -----------Acetyltransf_3-1yreD04 D:19-153                                                                                                        ----------------------------------------- Pfam domains (4)
         Sec.struct. author .......eee..eeeee.hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh..eeeeeeee..eeeeeeeeeeee....eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh....eeeeeee..hhhhhhhhhhhh.eeeeeeeeeee.....eeeeeeeeee..hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yre D   8 FKPLPITLQRGALRLEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLAEQREGRALPLAVRLGVQLVGTTRFAEFLPALPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLAGGRLDDTFVYSITDHEWPQVKAALEASFT 194
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Acyl-CoA N-acyltransferases (Nat) (250)

Superfamily: Acyl-CoA N-acyltransferases (Nat) (250)

Family: N-acetyl transferase, NAT (154)

Protein domain: automated matches (23)

Pseudomonas aeruginosa [TaxId: 208964] (2)

1a	d1yreb_	B:
1b	d1yrec_	C:
1c	d1yred_	D:

Protein domain: Hypothetical protein PA3270 (1)

Pseudomonas aeruginosa [TaxId: 287] (1)

d1yrea1

A:11-193

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Aminopeptidase (284)

Homologous Superfamily: [code=3.40.630.30, no name defined] (126)

Pseudomonas aeruginosa pao1. Organism_taxid: 208964. Strain: pao1. (1)

1a	1yreC00	C:12-193
1b	1yreA00	A:11-193
1c	1yreB00	B:8-194
1d	1yreD00	D:8-194

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Acetyltrans (109)

Family: Acetyltransf_3 (9)

Pseudomonas aeruginosa (2)

1a	Acetyltransf_3-1yreD01	D:19-153
1b	Acetyltransf_3-1yreD02	D:19-153
1c	Acetyltransf_3-1yreD03	D:19-153
1d	Acetyltransf_3-1yreD04	D:19-153

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (Q9HYX1_PSEAE | Q9HYX1)

molecular function
	GO:0008080	N-acetyltransferase activity	Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
biological process
	GO:0006474	N-terminal protein amino acid acetylation	The acetylation of the N-terminal amino acid of proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		COA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Leu A:92 - Pro A:93	[ RasMol ]
		Leu B:92 - Pro B:93	[ RasMol ]
		Leu C:92 - Pro C:93	[ RasMol ]
		Leu D:92 - Pro D:93	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1yre
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q9HYX1_PSEAE \| Q9HYX1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q9HYX1_PSEAE \| Q9HYX1
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1YRE)

(no "Related Entries Specified in the PDB File" available for 1YRE)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (1, 4)

Pfam Domains (1, 4)

Gene Ontology (2, 2)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File