Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF YEAST FSH1/YHR049W, A MEMBER OF THE SERINE HYDROLASE FAMILY
 
Authors :  N. Leulliot, M. Graille, F. Coste, S. Quevillon-Cheruel, J. Janin, H. Van Tilbeurgh, Paris-Sud Yeast Structural Genomics (Ysg)
Date :  22 Dec 04  (Deposition) - 10 May 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Esterase, Lipase, Serine Hydrolase, S. Cerevisiae, Structural Genomics, Paris-Sud Yeast Structural Genomics, Ysg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Quevillon-Cheruel, N. Leulliot, M. Graille, N. Hervouet, F. Coste, C. Zelwer, J. Janin, H. Van Tilbeurgh
Crystal Structure Of Yeast Yhr049W/Fsh1, A Member Of The Serine Hydrolase Family.
Protein Sci. V. 14 1350 2005
PubMed-ID: 15802654  |  Reference-DOI: 10.1110/PS.051415905
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL 27.3 KDA PROTEIN IN AAP1-SMF2 INTERGENIC REGION
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28
    Expression System Strain: ROSETTA(DE3)PLYSS
    Expression System Taxid: 562
    Fragment: S. CEREVISIAE YHR049WP
    Gene: YHR049W
    Mutation: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1LI52Ligand/Ion2-HYDROXY-4,5-DIOXOHEPTYL HYDROGEN PHOSPHONATE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1LI51Ligand/Ion2-HYDROXY-4,5-DIOXOHEPTYL HYDROGEN PHOSPHONATE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1LI51Ligand/Ion2-HYDROXY-4,5-DIOXOHEPTYL HYDROGEN PHOSPHONATE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:13 , PHE A:14 , PHE A:55 , HIS A:77 , SER A:110 , GLN A:111 , ALA A:185 , HIS A:218 , HOH A:1030 , HOH A:1084BINDING SITE FOR RESIDUE LI5 A 800
2AC2SOFTWAREGLY B:13 , PHE B:14 , PHE B:55 , SER B:110 , GLN B:111 , HIS B:218 , HOH B:1041 , HOH B:1043 , HOH B:1259BINDING SITE FOR RESIDUE LI5 B 800

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YCD)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric Unit
No.Residues
1Val A:3 -Gln A:4
2Gly A:101 -Pro A:102
3Gly B:101 -Pro B:102

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1YCD)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1YCD)

(-) Exons   (1, 2)

Asymmetric Unit (1, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1YHR049W1YHR049W.1VIII:206455-207186732FSH1_YEAST1-2432432A:3-239
B:4-241		237
238

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:237
 aligned with FSH1_YEAST | P38777 from UniProtKB/Swiss-Prot  Length:243

    Alignment length:237
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       
           FSH1_YEAST     3 VQIPKLLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEKKDLPFEMDDEKWQATLDADVNRAWFYHSEISHELDISEGLKSVVDHIKANGPYDGIVGFSQGAALSSIITNKISELVPDHPQFKVSVVISGYSFTEPDPEHPGELRITEKFRDSFAVKPDMKTKMIFIYGASDQAVPSVRSKYLYDIYLKAQNGNKEKVLAYEHPGGHMVPNKKDIIRPIVEQITSSLQ 239
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee.....hhhhhhhhhhhhhhhhhhh..eeeee...ee.hhhhh....hhhhhhhhhhh...ee......hhhhh.hhhhhhhhhhhhhhhh...eeeeehhhhhhhhhhhhhhhhhh.......eeeee.....eee.......eee.hhhh...........eeeeeee......hhhhhhhhhhhhhhhh......eeeeee........hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: A:3-239 UniProt: 1-243 [INCOMPLETE]                                                                                                                                                                                            Transcript 1
                 1ycd A   3 VQIPKLLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEKKDLPFEMDDEKWQATLDADVNRAWFYHSEISHELDISEGLKSVVDHIKANGPYDGIVGLSQGAALSSIITNKISELVPDHPQFKVSVVISGYSFTEPDPEHPGELRITEKFRDSFAVKPDMKTKMIFIYGASDQAVPSVRSKYLYDIYLKAQNGNKEKVLAYEHPGGHMVPNKKDIIRPIVEQITSSLQ 239
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       


Chain B from PDB  Type:PROTEIN  Length:238
 aligned with FSH1_YEAST | P38777 from UniProtKB/Swiss-Prot  Length:243

    Alignment length:238
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233        
           FSH1_YEAST     4 QIPKLLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEKKDLPFEMDDEKWQATLDADVNRAWFYHSEISHELDISEGLKSVVDHIKANGPYDGIVGFSQGAALSSIITNKISELVPDHPQFKVSVVISGYSFTEPDPEHPGELRITEKFRDSFAVKPDMKTKMIFIYGASDQAVPSVRSKYLYDIYLKAQNGNKEKVLAYEHPGGHMVPNKKDIIRPIVEQITSSLQEA 241
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) FSH1-1ycdB01 B:4-230                                                                                                                                                                                                               ----------- Pfam domains (1)
           Pfam domains (2) FSH1-1ycdB02 B:4-230                                                                                                                                                                                                               ----------- Pfam domains (2)
         Sec.struct. author ...eeeee.....hhhhhhhhhhhhhhhhhhh..eeeee...ee.hhhhh....hhhhhhhhhhh...ee......hhhhh.hhhhhhhhhhhhhhhh...eeeeehhhhhhhhhhhhhhhhhh.......eeeee.....eee.......eee.hhhh...........eeeeeee......hhhhhhhhhhhhhhhh......eeeeee........hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: B:4-241 UniProt: 1-243 [INCOMPLETE]                                                                                                                                                                                             Transcript 1
                 1ycd B   4 QIPKLLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEKKDLPFEMDDEKWQATLDADVNRAWFYHSEISHELDISEGLKSVVDHIKANGPYDGIVGLSQGAALSSIITNKISELVPDHPQFKVSVVISGYSFTEPDPEHPGELRITEKFRDSFAVKPDMKTKMIFIYGASDQAVPSVRSKYLYDIYLKAQNGNKEKVLAYEHPGGHMVPNKKDIIRPIVEQITSSLQEA 241
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1YCD)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1YCD)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: AB_hydrolase (347)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (FSH1_YEAST | P38777)
molecular function
    GO:0052689    carboxylic ester hydrolase activity    Catalysis of the hydrolysis of a carboxylic ester bond.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    LI5  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:101 - Pro A:102   [ RasMol ]  
    Gly B:101 - Pro B:102   [ RasMol ]  
    Val A:3 - Gln A:4   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ycd
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FSH1_YEAST | P38777
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FSH1_YEAST | P38777
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1YCD)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1YCD)