Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL GENOMICS, 1.9A CRYSTAL STRUCTURE OF AN ACETYLTRANSFERASE FROM BACILLUS CEREUS ATCC 14579
 
Authors :  R. Zhang, H. Li, F. Collart, A. Joachimiak, Midwest Center For Struc Genomics (Mcsg)
Date :  16 Dec 04  (Deposition) - 01 Feb 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Bacillus Cereus, Acetyltransferase, Structural Genomics, Protein Structure Initiative, Psi, Midwest Center For Structural Genomics, Mcsg, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Zhang, H. Li, F. Collart, A. Joachimiak
1. 9A Crystal Structure Of An Acetyltransferase From Bacillu Cereus Atcc 14579
To Be Published 2005
PubMed: search

(-) Compounds

Molecule 1 - ACETYLTRANSFERASE
    Chains: A, B
    EC Number: 2.3.1.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET15B
    Expression System Strain: BL21 (DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: BACILLUS CEREUS
    Organism Taxid: 226900
    Strain: ATCC 14579

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1Y9W)

(-) Sites  (0, 0)

(no "Site" information available for 1Y9W)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1Y9W)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1His A:127 -Pro A:128
2His B:127 -Pro B:128

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1Y9W)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1Y9W)

(-) Exons   (0, 0)

(no "Exon" information available for 1Y9W)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:140
 aligned with Q81CG1_BACCR | Q81CG1 from UniProtKB/TrEMBL  Length:140

    Alignment length:140
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140
         Q81CG1_BACCR     1 MYMKHIENGTRIEGEYIKNKVIQYNMSILTDEVKQPMEEVSLVVKNEEGKIFGGVTGTMYFYHLHIDFLWVDESVRHDGYGSQLLHEIEGIAKEKGCRLILLDSFSFQAPEFYKKHGYREYGVVEDHPKGHSQHFFEKRL 140
               SCOP domains d1y9wa1 A:1-140 Probable acetyltransferase BC2806                                                                                            SCOP domains
               CATH domains ------------------------------------1y9wA01 A:37-140  [code=3.40.630.30, no name defined]                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.hhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeee..eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeeee...hhhhhhhh..eeeeee........eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1y9w A   1 MYMKHIENGTRIEGEYIKNKVIQYNMSILTDEVKQPMEEVSLVVKNEEGKIFGGVTGTMYFYHLHIDFLWVDESVRHDGYGSQLLHEIEGIAKEKGCRLILLDSFSFQAPEFYKKHGYREYGVVEDHPKGHSQHFFEKRL 140
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140


Chain B from PDB  Type:PROTEIN  Length:140
 aligned with Q81CG1_BACCR | Q81CG1 from UniProtKB/TrEMBL  Length:140

    Alignment length:140
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140
         Q81CG1_BACCR     1 MYMKHIENGTRIEGEYIKNKVIQYNMSILTDEVKQPMEEVSLVVKNEEGKIFGGVTGTMYFYHLHIDFLWVDESVRHDGYGSQLLHEIEGIAKEKGCRLILLDSFSFQAPEFYKKHGYREYGVVEDHPKGHSQHFFEKRL 140
               SCOP domains d1y9wb_ B: Probable acetyltransferase BC2806                                                                                                 SCOP domains
               CATH domains ------------------------------------1y9wB01 B:37-140  [code=3.40.630.30, no name defined]                                                    CATH domains
           Pfam domains (1) --------------------------------------------Acetyltransf_1-1y9wB01 B:45-119                                            --------------------- Pfam domains (1)
           Pfam domains (2) --------------------------------------------Acetyltransf_1-1y9wB02 B:45-119                                            --------------------- Pfam domains (2)
         Sec.struct. author ....eeee.hhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeee..eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeeee...hhhhhhhh..eeeeee........eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1y9w B   1 MYMKHIENGTRIEGEYIKNKVIQYNMSILTDEVKQPMEEVSLVVKNEEGKIFGGVTGTMYFYHLHIDFLWVDESVRHDGYGSQLLHEIEGIAKEKGCRLILLDSFSFQAPEFYKKHGYREYGVVEDHPKGHSQHFFEKRL 140
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: Acetyltrans (109)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q81CG1_BACCR | Q81CG1)
molecular function
    GO:0008080    N-acetyltransferase activity    Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
    GO:0004596    peptide alpha-N-acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + peptide = CoA + N-alpha-acetylpeptide. This reaction is the acetylation of the N-terminal amino acid residue of a peptide or protein.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
    GO:0006474    N-terminal protein amino acid acetylation    The acetylation of the N-terminal amino acid of proteins.
cellular component
    GO:0031248    protein acetyltransferase complex    A complex that catalyzes the transfer of an acetyl group to a protein acceptor molecule.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1y9w)
 
  Sites
(no "Sites" information available for 1y9w)
 
  Cis Peptide Bonds
    His A:127 - Pro A:128   [ RasMol ]  
    His B:127 - Pro B:128   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1y9w
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q81CG1_BACCR | Q81CG1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q81CG1_BACCR | Q81CG1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1Y9W)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1Y9W)