|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1Y9T) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1Y9T) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1Y9T) |
Exons (0, 0)| (no "Exon" information available for 1Y9T) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:110 aligned with MXIM_SHIFL | P0A1X2 from UniProtKB/Swiss-Prot Length:142 Alignment length:110 42 52 62 72 82 92 102 112 122 132 142 MXIM_SHIFL 33 EKEWHIVPVSKDYFSIPNDLLWSFNTTNKSINVYSKCISGKAVYSFNAGKFMGNFNVKEVDGCFMDAQKIAIDKLFSMLKDGVVLKGNKINDTILIEKDGEVKLKLIRGI 142 SCOP domains -------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains MxiM-1y9tA01 A:33-142 Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 1y9t A 33 EKEWHIVPVSKDYFSIPNDLLWSFNTTNKSINVYSKCISGKAVYSFNAGKFMGNFNVKEVDGCFMDAQKIAIDKLFSMLKDGVVLKGNKINDTILIEKDGEVKLKLIRGI 142 42 52 62 72 82 92 102 112 122 132 142
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 1Y9T) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1Y9T) |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (MXIM_SHIFL | P0A1X2)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|