Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  IAA ACETYLTRANSFERASE FROM BACILLUS CEREUS ATCC 14579
 
Authors :  B. P. Nocek, J. Osipiuk, H. Li, F. Collart, A. Joachimiak, Midwest Cent Structural Genomics (Mcsg)
Date :  15 Dec 04  (Deposition) - 01 Feb 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.39
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Structural Genomics, Midwest Center For Structural Genomics (Mcsg), Bacillus Cereus Atcc 14579, Iaa Acetyltransferase, Acetyltransferase, Psi, Protein Structure Initiative, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. P. Nocek, J. Osipiuk, H. Li, F. Collart, A. Joachimiak
A Crystal Structure Of Iaa Acetyltransferase From Bacillus Cereus
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - IAA ACETYLTRANSFERASE
    ChainsA, B, C, D
    EC Number2.3.1.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePET15B
    Organism ScientificBACILLUS CEREUS ATCC 14579
    Organism Taxid226900
    StrainATCC 14579 / DSM 31

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 23)

Asymmetric Unit (1, 23)
No.NameCountTypeFull Name
1MSE23Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 5)
No.NameCountTypeFull Name
1MSE5Mod. Amino AcidSELENOMETHIONINE
Biological Unit 4 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1Y9K)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1Y9K)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1Y9K)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1Y9K)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1Y9K)

(-) Exons   (0, 0)

(no "Exon" information available for 1Y9K)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:152
 aligned with Q81FK8_BACCR | Q81FK8 from UniProtKB/TrEMBL  Length:155

    Alignment length:152
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150  
         Q81FK8_BACCR     1 MSVVIERIPKEAIPKSLLLLADPSERQIATYVQRGLTYVAKQGGSVIGVYVLLETRPKTMEIMNIAVAEHLQGKGIGKKLLRHAVETAKGYGMSKLEVGTGNSSVSQLALYQKCGFRIFSIDFDYFSKHYEEEIIENGIVCRDMIRLAMELN 152
               SCOP domains d1y9ka1 A:1-152 IAA acetyltransferase                                                                                                                    SCOP domains
               CATH domains ------------------1y9kA01 A:19-131  [code=3.40.630.30, no name defined]                                                            --------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeehhhhhhhhhhhhhh.hhhhhhhhhhhheeeeee....eeeeeeeee....eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhh..eeeeee.hhhhhhh...eee..eee..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1y9k A   1 mSVVIERIPKEAIPKSLLLLADPSERQIATYVQRGLTYVAKQGGSVIGVYVLLETRPKTmEImNIAVAEHLQGKGIGKKLLRHAVETAKGYGmSKLEVGTGNSSVSQLALYQKCGFRIFSIDFDYFSKHYEEEIIENGIVCRDmIRLAmELN 152
                            |       10        20        30        40        50        60  |     70        80        90  |    100       110       120       130       140   |   150  
                            |                                                         60-MSE                           93-MSE                                            144-MSE|   
                            1-MSE                                                        63-MSE                                                                               149-MSE

Chain B from PDB  Type:PROTEIN  Length:154
 aligned with Q81FK8_BACCR | Q81FK8 from UniProtKB/TrEMBL  Length:155

    Alignment length:154
                              1                                                                                                                                                       
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148    
         Q81FK8_BACCR     - --MSVVIERIPKEAIPKSLLLLADPSERQIATYVQRGLTYVAKQGGSVIGVYVLLETRPKTMEIMNIAVAEHLQGKGIGKKLLRHAVETAKGYGMSKLEVGTGNSSVSQLALYQKCGFRIFSIDFDYFSKHYEEEIIENGIVCRDMIRLAMELN 152
               SCOP domains d1y9kb_ B: automated matches                                                                                                                               SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee.hhhhhhhhhhhhhh.hhhhhhhhhhhheeeeeee..eeeeeeeeee....eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhh..eeeeee............ee..ee...eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1y9k B  -1 NAmSVVIERIPKEAIPKSLLLLADPSERQIATYVQRGLTYVAKQGGSVIGVYVLLETRPKTmEImNIAVAEHLQGKGIGKKLLRHAVETAKGYGmSKLEVGTGNSSVSQLALYQKCGFRIFSIDFDYFSKHYEEEIIENGIVCRDmIRLAmELN 152
                              |      8        18        28        38        48        58 |  |   68        78        88    |   98       108       118       128       138     | 148|   
                              1-MSE                                                     60-MSE                           93-MSE                                            144-MSE|   
                                                                                           63-MSE                                                                               149-MSE

Chain C from PDB  Type:PROTEIN  Length:150
 aligned with Q81FK8_BACCR | Q81FK8 from UniProtKB/TrEMBL  Length:155

    Alignment length:150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151
         Q81FK8_BACCR     2 SVVIERIPKEAIPKSLLLLADPSERQIATYVQRGLTYVAKQGGSVIGVYVLLETRPKTMEIMNIAVAEHLQGKGIGKKLLRHAVETAKGYGMSKLEVGTGNSSVSQLALYQKCGFRIFSIDFDYFSKHYEEEIIENGIVCRDMIRLAMEL 151
               SCOP domains d1y9kc_ C: automated matches                                                                                                                           SCOP domains
               CATH domains -----------------1y9kC01 C:19-131  [code=3.40.630.30, no name defined]                                                            -------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeehhhhhhhhhhhhhh.hhhhhhhhhhhheeeeeee..eeeeeeeeee....eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhh..eeeeee.hhhhhhh....ee..ee...eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1y9k C   2 SVVIERIPKEAIPKSLLLLADPSERQIATYVQRGLTYVAKQGGSVIGVYVLLETRPKTmEImNIAVAEHLQGKGIGKKLLRHAVETAKGYGmSKLEVGTGNSSVSQLALYQKCGFRIFSIDFDYFSKHYEEEIIENGIVCRDmIRLAmEL 151
                                    11        21        31        41        51        61 |      71        81        91 |     101       111       121       131       141  |    151
                                                                                     60-MSE                           93-MSE                                            144-MSE|  
                                                                                        63-MSE                                                                               149-MSE

Chain D from PDB  Type:PROTEIN  Length:153
 aligned with Q81FK8_BACCR | Q81FK8 from UniProtKB/TrEMBL  Length:155

    Alignment length:153
                              1                                                                                                                                                      
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148   
         Q81FK8_BACCR     - --MSVVIERIPKEAIPKSLLLLADPSERQIATYVQRGLTYVAKQGGSVIGVYVLLETRPKTMEIMNIAVAEHLQGKGIGKKLLRHAVETAKGYGMSKLEVGTGNSSVSQLALYQKCGFRIFSIDFDYFSKHYEEEIIENGIVCRDMIRLAMEL 151
               SCOP domains d1y9kd_ D: automated matches                                                                                                                              SCOP domains
               CATH domains --------------------1y9kD01 D:19-131  [code=3.40.630.30, no name defined]                                                            -------------------- CATH domains
           Pfam domains (1) -----------------------------------------Acetyltransf_1-1y9kD01 D:40-117                                               ---------------------------------- Pfam domains (1)
           Pfam domains (2) -----------------------------------------Acetyltransf_1-1y9kD02 D:40-117                                               ---------------------------------- Pfam domains (2)
           Pfam domains (3) -----------------------------------------Acetyltransf_1-1y9kD03 D:40-117                                               ---------------------------------- Pfam domains (3)
           Pfam domains (4) -----------------------------------------Acetyltransf_1-1y9kD04 D:40-117                                               ---------------------------------- Pfam domains (4)
         Sec.struct. author .....eeee.hhhhhhhhhhhhhh.hhhhhhhhhhhheeeeeee..eeeeeeeeee....eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhh..eeeeee.hhhhhhh...eee..eee..eeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1y9k D  -1 NAmSVVIERIPKEAIPKSLLLLADPSERQIATYVQRGLTYVAKQGGSVIGVYVLLETRPKTmEImNIAVAEHLQGKGIGKKLLRHAVETAKGYGmSKLEVGTGNSSVSQLALYQKCGFRIFSIDFDYFSKHYEEEIIENGIVCRDmIRLAmEL 151
                              |      8        18        28        38        48        58 |  |   68        78        88    |   98       108       118       128       138     | 148|  
                              |                                                         60-MSE                           93-MSE                                            144-MSE|  
                              1-MSE                                                        63-MSE                                                                               149-MSE

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit

(-) CATH Domains  (1, 3)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 4)

Asymmetric Unit

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (Q81FK8_BACCR | Q81FK8)
molecular function
    GO:0008080    N-acetyltransferase activity    Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
    GO:0004596    peptide alpha-N-acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + peptide = CoA + N-alpha-acetylpeptide. This reaction is the acetylation of the N-terminal amino acid residue of a peptide or protein.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
    GO:0006474    N-terminal protein amino acid acetylation    The acetylation of the N-terminal amino acid of proteins.
cellular component
    GO:0031248    protein acetyltransferase complex    A complex that catalyzes the transfer of an acetyl group to a protein acceptor molecule.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1y9k)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1y9k)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1y9k
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q81FK8_BACCR | Q81FK8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q81FK8_BACCR | Q81FK8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1Y9K)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1Y9K)