|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 15)
|
Asymmetric Unit (15, 15)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 1Y62) |
(no "SAP(SNP)/Variant" information available for 1Y62) |
Asymmetric Unit (1, 6)
|
(no "Exon" information available for 1Y62) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:56 aligned with VKTS1_CONST | P0C1X2 from UniProtKB/Swiss-Prot Length:86 Alignment length:56 38 48 58 68 78 VKTS1_CONST 29 RPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL 84 SCOP domains -------------------------------------------------------- SCOP domains CATH domains 1y62A00 A:3-58 Factor Xa Inhibitor CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE ----BPTI_KUNITZ_2 PDB: A:7-57 UniProt: 33-83 - PROSITE Transcript -------------------------------------------------------- Transcript 1y62 A 3 RPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL 58 12 22 32 42 52 Chain B from PDB Type:PROTEIN Length:56 aligned with VKTS1_CONST | P0C1X2 from UniProtKB/Swiss-Prot Length:86 Alignment length:56 38 48 58 68 78 VKTS1_CONST 29 RPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL 84 SCOP domains -------------------------------------------------------- SCOP domains CATH domains 1y62B00 B:3-58 Factor Xa Inhibitor CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE ----BPTI_KUNITZ_2 PDB: B:7-57 UniProt: 33-83 - PROSITE Transcript -------------------------------------------------------- Transcript 1y62 B 3 RPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL 58 12 22 32 42 52 Chain C from PDB Type:PROTEIN Length:56 aligned with VKTS1_CONST | P0C1X2 from UniProtKB/Swiss-Prot Length:86 Alignment length:56 38 48 58 68 78 VKTS1_CONST 29 RPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL 84 SCOP domains -------------------------------------------------------- SCOP domains CATH domains 1y62C00 C:3-58 Factor Xa Inhibitor CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE ----BPTI_KUNITZ_2 PDB: C:7-57 UniProt: 33-83 - PROSITE Transcript -------------------------------------------------------- Transcript 1y62 C 3 RPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL 58 12 22 32 42 52 Chain D from PDB Type:PROTEIN Length:56 aligned with VKTS1_CONST | P0C1X2 from UniProtKB/Swiss-Prot Length:86 Alignment length:56 38 48 58 68 78 VKTS1_CONST 29 RPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL 84 SCOP domains -------------------------------------------------------- SCOP domains CATH domains 1y62D00 D:3-58 Factor Xa Inhibitor CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE ----BPTI_KUNITZ_2 PDB: D:7-57 UniProt: 33-83 - PROSITE Transcript -------------------------------------------------------- Transcript 1y62 D 3 RPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL 58 12 22 32 42 52 Chain E from PDB Type:PROTEIN Length:56 aligned with VKTS1_CONST | P0C1X2 from UniProtKB/Swiss-Prot Length:86 Alignment length:56 38 48 58 68 78 VKTS1_CONST 29 RPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL 84 SCOP domains -------------------------------------------------------- SCOP domains CATH domains 1y62E00 E:3-58 Factor Xa Inhibitor CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE ----BPTI_KUNITZ_2 PDB: E:7-57 UniProt: 33-83 - PROSITE Transcript -------------------------------------------------------- Transcript 1y62 E 3 RPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL 58 12 22 32 42 52 Chain F from PDB Type:PROTEIN Length:56 aligned with VKTS1_CONST | P0C1X2 from UniProtKB/Swiss-Prot Length:86 Alignment length:56 38 48 58 68 78 VKTS1_CONST 29 RPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL 84 SCOP domains -------------------------------------------------------- SCOP domains CATH domains 1y62F00 F:3-58 Factor Xa Inhibitor CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE ----BPTI_KUNITZ_2 PDB: F:7-57 UniProt: 33-83 - PROSITE Transcript -------------------------------------------------------- Transcript 1y62 F 3 RPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL 58 12 22 32 42 52
|
(no "SCOP Domain" information available for 1Y62) |
Asymmetric Unit
|
(no "Pfam Domain" information available for 1Y62) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D,E,F (VKTS1_CONST | P0C1X2)
|
|
|
|
|
|
|