|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1Y2T) |
Sites (0, 0)| (no "Site" information available for 1Y2T) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1Y2T) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1Y2T) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1Y2T) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1Y2T) |
Exons (0, 0)| (no "Exon" information available for 1Y2T) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:142 aligned with ABL_AGABI | Q00022 from UniProtKB/Swiss-Prot Length:143 Alignment length:142 11 21 31 41 51 61 71 81 91 101 111 121 131 141 ABL_AGABI 2 TYTISIRVYQTTPKGFFRPVERTNWKYANGGTWDEVRGEYVLTMGGSGTSGSLRFVSSDTDESFVATFGVHNYKRWCDIVTNLTNEQTALVINQEYYGVPIRDQARENQLTSYNVANAKGRRFAIEYTVTEGDNLKANLIIG 143 SCOP domains d1y2ta_ A: TF antigen-binding lectin SCOP domains CATH domains 1y2tA00 A:2-143 [code=2.60.270.20, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1y2t A 2 TYTISIRVYQTTPKGFFRPVERTNWKYANGGTWDEVRGEYVLTMGGSGTSGSLRFVSSDTDESFVATFGVHNYKRWCDIVTNLTNEQTALVINQEYYGVPIRDQARENQLTSYNVANAKGRRFAIEYTVTEGDNLKANLIIG 143 11 21 31 41 51 61 71 81 91 101 111 121 131 141 Chain B from PDB Type:PROTEIN Length:142 aligned with ABL_AGABI | Q00022 from UniProtKB/Swiss-Prot Length:143 Alignment length:142 11 21 31 41 51 61 71 81 91 101 111 121 131 141 ABL_AGABI 2 TYTISIRVYQTTPKGFFRPVERTNWKYANGGTWDEVRGEYVLTMGGSGTSGSLRFVSSDTDESFVATFGVHNYKRWCDIVTNLTNEQTALVINQEYYGVPIRDQARENQLTSYNVANAKGRRFAIEYTVTEGDNLKANLIIG 143 SCOP domains d1y2tb_ B: TF antigen-binding lectin SCOP domains CATH domains 1y2tB00 B:2-143 [code=2.60.270.20, no name defined] CATH domains Pfam domains (1) FB_lectin-1y2tB01 B:2-141 -- Pfam domains (1) Pfam domains (2) FB_lectin-1y2tB02 B:2-141 -- Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1y2t B 2 TYTISIRVYQTTPKGFFRPVERTNWKYANGGTWDEVRGEYVLTMGGSGTSGSLRFVSSDTDESFVATFGVHNYKRWCDIVTNLTNEQTALVINQEYYGVPIRDQARENQLTSYNVANAKGRRFAIEYTVTEGDNLKANLIIG 143 11 21 31 41 51 61 71 81 91 101 111 121 131 141
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A,B (ABL_AGABI | Q00022)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|