|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1Y1C) |
Sites (0, 0)| (no "Site" information available for 1Y1C) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1Y1C) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1Y1C) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1Y1C) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:48 aligned with IELA_ANESU | P16895 from UniProtKB/Swiss-Prot Length:48 Alignment length:48 10 20 30 40 IELA_ANESU 1 KPDCPLICTMQYDPVCGSDGITYGNACMLLGASCRSDTPIELVHKGRC 48 SCOP domains ------------------------------------------------ SCOP domains CATH domains 1y1cA00 A:1-48 CATH domains Pfam domains -------Kazal_2-1y1cA01 A:8-48 Pfam domains SAPs(SNPs) ------------------------------------------------ SAPs(SNPs) PROSITE KAZAL_2 PDB: A:1-48 UniProt: 1-48 PROSITE Transcript ------------------------------------------------ Transcript 1y1c A 1 KPDAPCICTMQYDPVCGSDGITYGNACMLLCASARSDTPIELVHKGRC 48 10 20 30 40
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 1Y1C) |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (IELA_ANESU | P16895)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|